KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_1099Help
Entry
ECP_1099          CDS       T00373                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ecp00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ecp00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1154986..1155999
Genome map
AA seq 337 aa AA seqDB search
MLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRAASRNHLVVAVDQE
GGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAQEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHADPQKALAIASRFIDGMHEAGMKTTGKHFPGHGAVTADSHKETPCDPR
PQAEIRAKDMSVFSSLIRENKLDAIMPAHVIYSDVDPRPASGSPYWLKTVLRQELGFDGV
IFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTRLY
HKGSFSRQELMDSARWKAISARLNQLHERWQEEKAGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtcgaaggttacgaactggacgcggaagagcgtgaaatactggcgcatccg
ctggtgggagggctgattctctttacgcgaaactatcatgatcctgcccagttacgtgaa
ctggtgcgccagatccgcgcagcatcgcgcaatcatctggtggtggcggtagatcaggaa
ggtggacgcgtgcagcgttttcgtgaaggttttacccgcttgccagcggcacaatcattc
gctgcgctgttgggaatggaagaaggcggaaaactggcgcaagaggcaggttggttgatg
gccagtgaaatgattgctatggatattgatatcagctttgcgccagtgctggacgtcggg
catatcagcgcggcgattggcgagcgttcttatcatgccgatccacaaaaagccctggca
attgccagccgttttattgatggtatgcatgaagcgggaatgaaaactaccgggaaacac
ttcccaggtcacggtgcagtaacggcagactcacacaaagaaacaccgtgcgacccacgt
ccgcaagcggagattcgcgctaaagatatgtcggtcttcagttccttaatccgcgaaaat
aaactcgacgccattatgcctgcgcatgtgatctacagtgatgttgatccgcgtccggcg
agcggttctccctactggctgaaaaccgttttgcgtcaggaattgggttttgacggcgtg
attttctctgacgatttatcgatggaaggcgcagcgattatgggcagttatgccgagcgt
ggacaggcatcactggatgcaggttgcgatatgatcctggtctgcaataatcgtaaaggg
gccgtcagcgtgttagataatctgtcaccgatcaaggcagaacgtgttacacgtttgtat
cataaaggttcattttcgcgacaggaactgatggactcggctcgctggaaagcgatcagc
gcccgtctgaatcagttacatgaacgctggcaggaagagaaggcaggtcattaa

DBGET integrated database retrieval system