KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_1099Help
Entry
ECP_1099          CDS       T00373                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ECP_1099
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    ECP_1099
Enzymes [BR:ecp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ECP_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1154986..1155999
Genome map
AA seq 337 aa AA seqDB search
MLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRAASRNHLVVAVDQE
GGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAQEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHADPQKALAIASRFIDGMHEAGMKTTGKHFPGHGAVTADSHKETPCDPR
PQAEIRAKDMSVFSSLIRENKLDAIMPAHVIYSDVDPRPASGSPYWLKTVLRQELGFDGV
IFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTRLY
HKGSFSRQELMDSARWKAISARLNQLHERWQEEKAGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtcgaaggttacgaactggacgcggaagagcgtgaaatactggcgcatccg
ctggtgggagggctgattctctttacgcgaaactatcatgatcctgcccagttacgtgaa
ctggtgcgccagatccgcgcagcatcgcgcaatcatctggtggtggcggtagatcaggaa
ggtggacgcgtgcagcgttttcgtgaaggttttacccgcttgccagcggcacaatcattc
gctgcgctgttgggaatggaagaaggcggaaaactggcgcaagaggcaggttggttgatg
gccagtgaaatgattgctatggatattgatatcagctttgcgccagtgctggacgtcggg
catatcagcgcggcgattggcgagcgttcttatcatgccgatccacaaaaagccctggca
attgccagccgttttattgatggtatgcatgaagcgggaatgaaaactaccgggaaacac
ttcccaggtcacggtgcagtaacggcagactcacacaaagaaacaccgtgcgacccacgt
ccgcaagcggagattcgcgctaaagatatgtcggtcttcagttccttaatccgcgaaaat
aaactcgacgccattatgcctgcgcatgtgatctacagtgatgttgatccgcgtccggcg
agcggttctccctactggctgaaaaccgttttgcgtcaggaattgggttttgacggcgtg
attttctctgacgatttatcgatggaaggcgcagcgattatgggcagttatgccgagcgt
ggacaggcatcactggatgcaggttgcgatatgatcctggtctgcaataatcgtaaaggg
gccgtcagcgtgttagataatctgtcaccgatcaaggcagaacgtgttacacgtttgtat
cataaaggttcattttcgcgacaggaactgatggactcggctcgctggaaagcgatcagc
gcccgtctgaatcagttacatgaacgctggcaggaagagaaggcaggtcattaa

DBGET integrated database retrieval system