KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_1287Help
Entry
ECP_1287          CDS       T00373                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ECP_1287
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECP_1287
   00620 Pyruvate metabolism
    ECP_1287
   00650 Butanoate metabolism
    ECP_1287
  Lipid metabolism
   00071 Fatty acid degradation
    ECP_1287
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECP_1287
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECP_1287
   00626 Naphthalene degradation
    ECP_1287
Enzymes [BR:ecp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECP_1287
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECP_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1318236..1320911)
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFATHGGYLLQGKELKAVQDVILKNGALNAAIVGQP
AYKIAELAGFSVPENTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPARVSYFGQKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSIVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDTTGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHAME
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLETLKAELGIPKSIREAGVQEADFLANVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDYVEGETAAKKEAAPAKAEKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagagcaagtagacaaaatcttccgcgccgccgctctg
gctgctgcagatgctcgaatcccactcgcgaaaatggccgttgccgaatccggcatgggt
atcgtcgaagataaagtgatcaaaaaccactttgcttctgaatatatctacaacgcttat
aaagatgaaaaaacctgtggtgttctgtctgaagacgacacttttggtaccatcactatc
gctgaacccatcggtattatttgcggtatcgttccgaccactaacccgacttcaactgct
atcttcaaatcgctgatcagcctgaagacccgtaacgccattatcttctccccgcacccg
cgtgcaaaagatgccaccaacaaagcggctgatatcgttctacaggctgctatcgctgcc
ggtgctccgaaagatctgatcggctggatcgatcaaccttctgttgagctgtctaacgca
ctgatgcaccacccagacatcaacctgatcctcgcgactggtggtccgggcatggttaaa
gccgcatacagctccggtaaaccagctatcggcgtaggcgcgggcaacactccggttgtt
atcgatgaaactgctgatatcaaacgtgcagttgcatctgtactgatgtccaaaaccttc
gacaacggtgtaatctgtgcttctgaacagtctgttgttgttgttgactctgtttatgac
gcagtacgtgaacgtttcgcaacccacggcggctatctgttgcagggtaaagagctgaaa
gctgttcaggacgttatcctgaaaaacggtgcgctgaacgcggctatcgttggtcagcca
gcctataaaattgctgaactggcaggcttctctgtaccagaaaacaccaagattctgatc
ggtgaagtgaccgttgttgatgaaagcgaaccgttcgcacatgaaaaactgtccccgact
ctggcaatgtaccgtgctaaagatttcgaagacgcggtagaaaaagcagagaaactggtt
gctatgggcggtatcggtcacacctcttgcctgtacactgaccaagataaccaaccggct
cgcgtttcttacttcggtcagaaaatgaaaacggctcgtatcctgattaacaccccggct
tctcagggtggtatcggtgacctgtataacttcaaactcgcaccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctccctgccaatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgactgaccgcttcctgttcaacaatggttatgctgatcagatcact
tccgtattgaaagcagcaggcgttgaaactgaagtcttcttcgaagtagaagctgacccg
accctgagcatcgttcgtaaaggtgcagaactggcaaactccttcaaaccagacgtgatt
atcgcgctgggtggtggttccccgatggacgctgcgaagatcatgtgggttatgtacgaa
catccggaaactcacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggtgtgaaagcgaaaatgatcgctgtcaccaccacttctggt
acaggttctgaagtcactccgtttgcggttgtaactgacgacactactggtcagaaatat
ccgctggcagactatgcactgaccccggatatggcgattgtcgacgccaaccttgttatg
gacatgccgaagtccctgtgtgctttcggtggtctggacgcagtaactcacgccatggaa
gcttatgtttctgtactggcatctgagttctctgatggtcaggctctgcaggcactgaaa
ctgctgaaagaatatctgccagcgtcctaccacgaagggtctaaaaatccggtagcgcgt
gaacgtgttcacagtgcagcgactatcgcgggtatcgcgtttgcgaacgccttcctgggt
gtatgtcactcaatggcgcacaaactgggttcccagttccatattccgcacggtctggca
aacgccctgctgatttgtaacgttattcgctacaacgcgaatgacaacccgaccaagcag
actgcattcagccagtatgaccgtccgcaggctcgccgtcgttatgctgaaattgctgac
cacctgggtctgagcgcaccgggcgaccgtactgcagctaagatcgagaaactgctggca
tggctggaaacgctgaaagctgaactgggtattccgaaatctatccgtgaagctggcgtt
caggaagcagacttcctggcgaacgtggataaactgtctgaagatgcattcgatgaccag
tgcaccggcgctaacccgcgttacccgctgatctccgagctgaaacagattctgctggat
acctactacggtcgtgattatgtagaaggcgaaactgcagcgaagaaagaagctgctccg
gctaaagctgagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system