KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_1308Help
Entry
ECP_1308          CDS       T00373                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00260  Glycine, serine and threonine metabolism
ecp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecp01100  Metabolic pathways
ecp01110  Biosynthesis of secondary metabolites
ecp01130  Biosynthesis of antibiotics
ecp01230  Biosynthesis of amino acids
Module
ecp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECP_1308
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECP_1308
Enzymes [BR:ecp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECP_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABG69319
UniProt: Q0TIB0
Structure
PDB: 

Jmol
Position
complement(1338001..1338807)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGTPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEVLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAECEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcaccctcggtgatccgggcattgagcagtcgttgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggaattaggcacccccttctccgacccactggcggat
ggcccgacgattcaaaacgccacactgcgtgcttttgcggcgggagtaaccccggcgcag
tgctttgaggtgctggcactcattcgccagaagcacccgaccattcccatcggccttttg
atgtatgccaacctggtgtttaacaaaggcattgatgagttttatgccgagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgcccgtggaagagtccgcgcccttccgc
caggccgcgttgcgtcataatgtcgcacctatctttatttgcccgccgaatgccgacgat
gatttgctgcgccagatagcctcttacggtcgtggttacacctatttgctgtcgcgagcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgctgcgcctccattgcagggatttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcggccatcgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagcttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system