KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_1361Help
Entry
ECP_1361          CDS       T00373                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECP_1361
Enzymes [BR:ecp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     ECP_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1391665..1393371
Genome map
AA seq 568 aa AA seqDB search
MGPLPRKGNMKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVL
ITYADQFHSNDLKPLPTFNQFYPQWLQRIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAG
EWQDIQQLGECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAVDPKTDLSAVTRPR
ALPLLTPFQMRDHSMRHLWSTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAV
GFMWKEPGTSCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGEGDDEAH
MVYQFSLPPLVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPE
NEILALVEVLQQEGALVNWKNNPDGTRSPYEMNVTYMDALSRRECSDEERCARFILAHAI
LLSFPGVPAIYIQSILGSRNDYAGVEKLGYNRAINRKKYSSKEITTELNNKATLRYSIYY
KLSHLITLRRSHKEFHPDNNFTIDAINSFVMRIQRSNADGDCLTGLFNVSENIQHINITD
LHGRDLISEVDILGNEITLHPWQVMWIK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctaccacggaaaggcaacatgaaacagaaaattacggattacctggacgaa
atctacggtggaacatttaccgcgactcatttacagaaacttgtaacgcgtcttgagagt
gcgaaacgattaattacacagcgacgtaaaaaacactgggatgaaagtgatgtcgtgtta
attacctatgccgatcaatttcacagtaatgatttaaagccactacccacatttaatcag
ttttaccctcaatggctgcaaagaattttttcacatgttcatttattacctttttatcca
tggtcatctgatgatggattttcggtaattgattatcatcaggtcgccagtgaagcgggg
gagtggcaggatattcagcaactcggtgaatgcagccatttaatgtttgattttgtctgc
aaccatatgtcggcaaaaagtgaatggtttaaaaactatttacaacagcagccaggtttt
gaagatttttttattgccgttgatccgaaaaccgatctcagcgccgtcactcgcccgcgt
gcgttaccgttattaacgccattccagatgcgcgatcattcaatgcgccatttatggagc
acctttagcgacgatcaaattgacctcaattaccgtagccctgaagtgttgctggcgatg
gtggatgtattgctgtgctacctggaaaagggcgcagagtatgtccgtctggatgccgtt
ggctttatgtggaaagagccgggaacaagctgcatccatctggaaaaaacacatctgatt
atcaaactgttacggtcgattattgataacgtcgcgccaggcacagtgatcattaccgag
accaatgttccgcataaagacaacattgcttactttggcgaaggcgatgacgaagcgcat
atggtgtaccagttctcgctgccgccgctggtgctgcatgcggtgcaaaaacagaacgtt
gaggcactttgtgcctgggcgcaaaacctgacactaccttccagcaacaccacctggttt
aacttccttgcctctcacgatggcatcgggcttaacccactgcgggggttgttgcccgaa
aacgaaatattagcgctggtcgaggtgttacagcaggaaggggcattagtaaactggaaa
aataatcccgacggtacgcgtagcccctatgaaatgaatgtcacctatatggatgcgttg
agccgccgtgagtgtagcgacgaagaacggtgtgccaggtttattctcgcccatgcgatt
ttgttaagttttcccggtgtgccagcgatatatattcaaagcattctggggtcgcgtaat
gattacgcaggtgtcgaaaaacttggatataatcgcgcgattaaccgtaaaaaatactct
agtaaagagataacgacagaactgaacaataaagcgacattaaggtattcgatatattat
aagttgtcgcatttaattacacttcgtcgcagtcataaagagtttcatccggataataat
ttcaccatcgatgcgattaattcatttgtaatgcgaattcaaagaagcaatgcggatggc
gattgcctgacgggattgtttaatgtcagtgaaaatattcagcatataaatattactgac
ctgcacggtcgggatctgattagtgaagttgatatattgggtaatgaaataacactgcat
ccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system