KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_1516Help
Entry
ECP_1516          CDS       T00373                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECP_1516 (celA)
Enzymes [BR:ecp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECP_1516 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1565198..1566637)
Genome map
AA seq 479 aa AA seqDB search
MSGFKEDFLWGGAVAAHQLEGGWNEGGKGISIADVMTAGAHGVPREVTEGVIDGLNYPNH
EAIDFYHRYKTDIQLFAGMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFYDDLFDECLKQ
GMEPVVTLSHFEMPYHLVTKYGGWRNRKLIDFFIHFASTVFTRYKEKVKYWMTFNEINNQ
VNFSESLCPFTNSGILYSPEEDLNEREQIMYQAVHYELVASALAVQTGKLINPEFNIGCM
IAMCPIYPLTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKGFNLDITPDDN
AILARGCVDFIGFSYYMSFTTQFSPDNPQLDYVEPRDLVSNPYIDTSEWGWQIDPAGLRY
SLNWFWDHFQLPLFIVENGFGAVDQRQADGTVNDHYRIDYFSSHIREMKKAVVEDGVDLI
GYTPWGCIDLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRDLIANNGENI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatttaaagaagattttttatggggcggtgcggtagccgcacatcaattggaa
ggtggctggaatgaaggaggaaaaggcatcagtatcgctgatgtaatgactgctggcgct
cacggggtgccgcgtgaagtgacagaaggcgttatcgacggacttaattatcccaatcat
gaagcaattgatttttatcatcgctataaaacagatattcagttatttgccgggatggga
ttcaaatgctttcgaacttccattgcctggacacgaatctttccgcaaggtgacgaacag
gagccgaatgaagagggtttacaattttatgatgatctcttcgatgaatgcctgaagcag
ggaatggaacctgtggtgacgctttcgcattttgagatgccttatcatctggtgacaaaa
tatggtggctggcgaaaccgtaaactgatcgacttttttatccacttcgcatcaacggtc
ttcacgcgctataaagaaaaagtaaagtactggatgacgtttaacgaaatcaataatcag
gtgaatttcagcgaaagcctgtgtccatttactaattccggtatcttgtattcgccagag
gaagatctcaatgagcgcgaacaaataatgtaccaggcggtacattatgagttagttgcc
agtgccctggcggtacagactggaaaactgatcaatcctgaatttaatatcggctgtatg
attgctatgtgccccatctatcctctgacgtgtgcacccaacgatatgatgatggccacg
aaagcgatgcatcgtcgttactggtttactgatgttcatgctcgtggatattatccgcaa
catatgctgaattactttgcaaggaaaggattcaacctcgatatcacaccagatgataac
gcgattcttgccagaggttgtgtcgactttatcggctttagctactacatgtcttttacg
acgcaattttcgccagataatccgcaactggattatgttgaaccacgagatttggtcagc
aacccttatatcgatacatccgaatggggatggcaaattgatccggcagggctacgttat
tcactcaactggttctgggatcatttccagttgccgctgtttattgtcgaaaatggattt
ggtgcggttgaccagagacaagctgacggcacggtgaacgatcactatcgcattgattac
ttttcctcccatattcgggaaatgaaaaaagccgtagttgaagatggtgttgacttaatt
ggctacaccccgtggggttgcattgacctggtttctgccggaacaggagaaatgaaaaaa
cgctacggaatgatttatgtcgataaagacaacgaagggaagggaacgctggaacggata
cgtaaagcatcgttttactggtatcgggatctcatcgccaacaatggcgaaaatatatga

DBGET integrated database retrieval system