KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_1658Help
Entry
ECP_1658          CDS       T00373                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ECP_1658 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ECP_1658 (btuE)
Enzymes [BR:ecp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ECP_1658 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1708345..1708896)
Genome map
AA seq 183 aa AA seqDB search
MQDSILTTVVKDIDGKVTTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGLVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccattctgacgaccgtagtgaaagatattgacggtaaagtgaccacgctg
gagaagtacgccggtaatgtgctgttgattgtcaatgtcgcctcaaagtgtggcttaacg
ccgcaatatgagcagttggagaatattcagaaagcctgggctgatcgtggttttgtggtg
ctgggattcccgtgtaaccagtttctggagcaagaaccgggtagcgatgaagagattaaa
acttattgcaccaccacatggggggtgacgttcccgatgttcagtaagattgaagttaat
ggcgaaggacgtcatccgctgtatcaaaaattgattgccgcagcgccgactgcagtcgcg
ccggaagagagcggattctatgcccgaatggtcagcaaaggtcgtgcaccgctgtaccct
gatgatattttatggaattttgagaaatttttagttggcagggacggattggtcatccag
cgtttttccccggatatgacgccggaagatcccattgtgatggaaagcattaaactggcg
ttggcaaaataa

DBGET integrated database retrieval system