KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_1716Help
Entry
ECP_1716          CDS       T00373                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECP_1716
Enzymes [BR:ecp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     ECP_1716
    3.5.1.-  
     ECP_1716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1769295..1769936
Genome map
AA seq 213 aa AA seqDB search
MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWHPANHGS
FASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLKQKAIAAVFHKGENPLVDSY
SAFFDNGRRQKTALDDWLRAHVINELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccccctcgcgccctgttactggtcgatttacaaaatgatttctgtgctggtggcgcg
ctcgccgtgccggaaggtgacagtacggtggatgtcgctaaccgcctgattgactggtgc
cagtcgcgcggtgaagcggttatcgccagtcaggactggcacccggcgaatcacggcagt
tttgccagtcagcacggtgtagagccttatacgccgggccaactcgacggtttgccacaa
accttctggcccgatcactgtgtgcagaacagtgaaggcgcacaattacatccgttactg
aagcaaaaagcgatcgcagcggtgttccataaaggcgaaaatcctttagttgacagttac
agtgccttttttgataacggccgtcggcagaaaactgcgctcgatgactggttgcgcgct
catgtaatcaatgaattgatcgttatgggtctggctactgactattgcgttaagtttacc
gtgctggacgcgttacagttaggctataaggtgaacgtgattaccgatggttgtcgtggc
gtaaatatccagccacaggacagtgcgcacgcgtttatggagatgtcagcagctggggca
acgctatatacgctggcagactgggaagaaacgcaggagtaa

DBGET integrated database retrieval system