KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_2379Help
Entry
ECP_2379          CDS       T00373                                 

Definition
(GenBank) putative fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00071  Fatty acid degradation
ecp00280  Valine, leucine and isoleucine degradation
ecp00281  Geraniol degradation
ecp00310  Lysine degradation
ecp00362  Benzoate degradation
ecp00380  Tryptophan metabolism
ecp00410  beta-Alanine metabolism
ecp00640  Propanoate metabolism
ecp00650  Butanoate metabolism
ecp00903  Limonene and pinene degradation
ecp00930  Caprolactam degradation
ecp01040  Biosynthesis of unsaturated fatty acids
ecp01100  Metabolic pathways
ecp01110  Biosynthesis of secondary metabolites
ecp01120  Microbial metabolism in diverse environments
ecp01130  Biosynthesis of antibiotics
ecp01200  Carbon metabolism
ecp01212  Fatty acid metabolism
Module
ecp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECP_2379
   00650 Butanoate metabolism
    ECP_2379
  Lipid metabolism
   00071 Fatty acid degradation
    ECP_2379
   01040 Biosynthesis of unsaturated fatty acids
    ECP_2379
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECP_2379
   00310 Lysine degradation
    ECP_2379
   00380 Tryptophan metabolism
    ECP_2379
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECP_2379
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECP_2379
   00281 Geraniol degradation
    ECP_2379
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECP_2379
   00930 Caprolactam degradation
    ECP_2379
Enzymes [BR:ecp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECP_2379
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECP_2379
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECP_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABG70373
UniProt: Q0TFA6
Position
complement(2489012..2491156)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAIITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEVLARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAV
KLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRNIFFASTEVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYCGFAHRDLIIEAVFENLELKQQMVAEVEQNCATHTIF
ASNTSSLPIGDIAAHAARPEQVIGLHFFSPVEKMPLVEIIPHASTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERIEHIDTALVKFGFPVGPIQLLDEVG
IDTGTKIMPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVCCLDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCNRFVEMSERGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggaatttgcctcgcaggtacgc
gccattattaagcaactccgtgaaaacaaagagttgcgtggcgtggtgtttgtctccgcg
aaaccagacaacttcattgctggcgcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagtactggcgcggcaggggcaacagttaatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggcggcgggctggagttggcg
ctggcgtgccacggtcgtgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggtacccagcgtttaccgcgcctgataggt
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcagta
aagctggggttggtggatgacgtcgttccgcactccatattgctggaagccgctgttgag
ctggcaaagcaggatcgcccatcttcacgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggtaagaaaacagaacacaaaacg
caaggtaactatccggcgacagaacgcatcctggaggttgtcgaaacgggattagcgcag
ggcaccagcagcggctatgacgctgaagcacgggcgtttggcgaactggcgatgacgccg
caatcgcaggcgctgcgcaatatcttttttgccagtacggaagtgaaaaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactattgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgctactcataccatcttt
gcttcgaacacgtcatctttaccgattggcgatatcgccgctcacgctgcgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcgagtacatcggcgcaaaccatcgccaccacggtaaaactggcgaaaaaacag
ggcaaaacgccaattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacatcaatgaagctatccgcatgttgaccgaaggcgagcgtattgagcatatcgat
accgcgctagtgaaatttgggtttccggtaggcccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattatgcctgtactggaagctgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggc
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtatgttgtctggacgagcaggttatccgt
agcgtgcgtgacggggatattggcgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcaggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcaatcgtttcgttgagatgagcgag
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system