KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_2388Help
Entry
ECP_2388          CDS       T00373                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECP_2388
   00500 Starch and sucrose metabolism
    ECP_2388
Enzymes [BR:ecp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECP_2388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2499735..2501168
Genome map
AA seq 477 aa AA seqDB search
MTQSRLHAAQNALAKLHEHRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHHPMS
EHWGPMHWGHATSDDMIHWQHEPIALAPGDENDKDGCFSGSAVDDNGVLSLIYTGHVWLD
GAGNDDAIREVQCLATSRDGIHFEKQGVILTPPEGIMHFRDPKVWREADTWWMVVGAKDP
GNTGQILLYRGSSLREWTFDRVLAHADAGESYMWECPDFFSLGDQHYLMFSPQGMNAEGY
SYRNRFQSGVIPGMWSPGRLFAQSGHFTELDNGHDFYAPQSFLAKDGRRIVIGWMDMWES
PMPSKREGWAGCMTLARELSESNGKLLQRPVHEAESLRQQHQSISPRTISNKYVLQKNAQ
AVEIQLQWALKNSDAEHYGLQLGTGMRLYIDNQSERLVLWRYYPHEHLDGYRSIPLPQGD
MLALRIFIDTSSVEVFINDGEAVMSSRIYPQPEKRELSLYASHGVAVLQHGALWQLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatctcgattgcatgcggcgcaaaacgcactagcaaaacttcatgagcaccgg
ggtaacactttctatccccattttcacctcgcgcctcctgccgggtggatgaacgatcca
aacggcctgatctggtttaacgatcgttatcacgcgttttatcaacatcacccgatgagt
gaacactgggggccaatgcactggggacatgccaccagcgacgatatgatccactggcag
catgagcctattgcgctagcgcctggagacgagaatgacaaagacgggtgtttttcaggt
agtgctgtcgatgacaatggtgtcctctcacttatctacaccggacacgtctggctcgat
ggtgcaggtaatgacgatgcaattcgcgaagtacaatgtctggctaccagtcgggatggt
attcatttcgagaaacagggtgtgatcctcactccaccagaaggaatcatgcacttccgc
gatcctaaagtgtggcgtgaagccgacacatggtggatggtagtcggggcgaaagaccca
ggtaacacggggcagatactgctttatcgcggcagttcattgcgtgaatggactttcgat
cgcgtactggcccacgctgatgcgggtgaaagctatatgtgggaatgtccggactttttc
agccttggcgatcagcattatctgatgttttccccgcagggaatgaatgccgagggatac
agttatcgaaatcgctttcaaagtggcgtaatacccggaatgtggtcgccaggacgactt
tttgcacaatccgggcattttactgaacttgataacggacatgacttttatgcaccacaa
agctttttagcgaaggatggtcggcgtattgttatcggctggatggatatgtgggaatcg
ccaatgccctcaaaacgtgaaggctgggcaggctgcatgacgctggcgcgcgagctatca
gagagcaatggcaaactcctacaacgcccggtacatgaagctgagtcgttacgccagcag
catcaatctatctctccccgcacaatcagcaataaatatgttttgcagaaaaacgcgcaa
gcagttgagattcagttgcagtgggcgctgaagaacagtgatgccgaacattacggatta
caactcggcacaggaatgcggctgtatattgataaccaatctgagcggcttgttttgtgg
cggtattacccacacgagcatttagacggctaccgtagtattcccctcccgcagggtgac
atgctcgccctaaggatatttatcgatacatcatccgtggaagtatttattaacgacggg
gaggcggtaatgagtagccgaatatatccgcagccagaaaaacgggaactgtcgctctat
gcctcccacggagtggctgtgctgcaacatggagcactctggcaactgggttaa

DBGET integrated database retrieval system