KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_2724Help
Entry
ECP_2724          CDS       T00373                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Brite
Enzymes [BR:ecp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ECP_2724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2863794..2863946)
Genome map
AA seq 50 aa AA seqDB search
MTQLDEGGILVLPVGEEHQYLKRVRRRGGEFIIDTVEAVRFVPLVKGELA
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagctggacgaaggcgggattctcgtcttacccgtaggggaggagcaccagtat
ttaaaacgggtgcgtcgtcggggaggcgaatttattatcgataccgtggaggccgtgcgc
tttgtccctttagtgaagggtgagctggcttaa

DBGET integrated database retrieval system