KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_3952Help
Entry
ECP_3952          CDS       T00373                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECP_3952
Enzymes [BR:ecp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ECP_3952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4121069..4122013
Genome map
AA seq 314 aa AA seqDB search
MDIPNMQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSG
ANIAFIACTGDDSIGESVRQQLATDNIDISPVSVIKGESTGVALIFVNGEGENVIGIHAG
ANAALSPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPD
ELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNG
EGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKTLPEAIRFAHAAAAIAVTRKGAQPSV
PWREEIDAFLDRQR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacatcccgaatatgcaaaacgcaggcagcctcgttgttcttggcagcattaatgct
gaccacattcttaatcttcaatcttttcctactccaggcgaaaccgtaaccggtaaccac
tatcaggttgcatttggcggcaaaggcgcgaatcaggcggtggctgctgggcgtagcggt
gcgaatatcgcgtttattgcctgcactggcgatgacagcattggtgagagcgttcgccag
cagctcgccactgataacatcgatatttctccggtcagcgtgatcaaaggcgaatcaaca
ggtgtggcgctgatttttgttaatggcgaaggtgagaatgtcatcggtattcatgccggc
gctaatgctgccctttccccggcgctggtggaagcgcaacgtgagcgtattgccaacgcg
tcagcattattaatgcagctggaatcaccactcgaaagtgtgatggcagcggcgaaaatc
gcccatcaaaataagactatcgttgcgcttaacccggctccggctcgcgaacttcctgac
gaactgctggcgctggtggacattattacgccaaacgaaacggaagcagaaaagctcacc
ggtattcgtgttgaaaatgatgaagatgcagcgaaggcggcgcaggtactgcatgaaaaa
ggtatccgtactgtactgattactttaggaagtcgtggtgtatgggctagcgtgaatggt
gaaggtcagcgcgttcctggattccgggtgcaggctgtcgataccattgctgccggagat
acctttaacggcgcgttaatcacggcgttgctggaagaaaaaacattgccagaggcgatt
cgttttgcccatgcagccgctgcgattgccgtaacacgtaaaggcgcacaaccttccgta
ccgtggcgtgaagagatcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system