KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4059Help
Entry
ECP_4059          CDS       T00373                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECP_4059 (fadB)
   01212 Fatty acid metabolism
    ECP_4059 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECP_4059 (fadB)
   00650 Butanoate metabolism
    ECP_4059 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ECP_4059 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ECP_4059 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECP_4059 (fadB)
   00310 Lysine degradation
    ECP_4059 (fadB)
   00380 Tryptophan metabolism
    ECP_4059 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECP_4059 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECP_4059 (fadB)
   00281 Geraniol degradation
    ECP_4059 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    ECP_4059 (fadB)
Enzymes [BR:ecp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECP_4059 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECP_4059 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECP_4059 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     ECP_4059 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4234643..4236832)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLVEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFNANRFGQKNGLGFWRYKEDSKGKP
KKEEDVVVDDLLAKVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGMRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgccaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctcccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctcggtgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggtgtagtcaaagcagaaaaactggttgaaggggcgatggcgatt
ttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaagctggaa
ccgctaaaactgagcaagattgaagccgccatgagcttcaccatcgctaaagggatggtc
gcgcaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccattgaagcg
gcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtcccgctg
gcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggtaaagcgaagaaactcaccaaagatgttgaaaccccgaaacaggccgctgtgctgggc
gcaggcattatgggcggcggcatcgcctaccagtctgcgtggaaaggcgtgccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatctccaca
attcacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaagcggtt
gttgaaaacccgaaagtgaaaaaagccgtgctggcagaaaccgagcagaaagtacgcccg
gataccgtactggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgtccggaaaacttctgcgggatgcacttctttaacccggtccaccgaatgccgtta
gtagaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagtcgtcgcctgg
gcgagcaaaatgggcaaaacgccgattgtggttaacgactgccccggcttcttcgtcaac
cgtgtactgttcccctatttcgccggtttcagccagttgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggtccggcatatctg
ctggatgttgtgggcattgacaccgcacatcatgcccaggcagtcatggcagcaggcttc
ccgcagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttaatgccaaccgc
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagatgtcgtcgttgacgacctgctggcaaaagtgagccagccgaagcgc
gatttcagcgaggaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtc
cgctgtctggaagagggcattatcgccactccggcagaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggcagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaagtaccg
gaaggtatgcgtaataaagcacgtcataacgaaccgtactatcccccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system