KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4093Help
Entry
ECP_4093          CDS       T00373                                 

Definition
aldose-1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECP_4093
   00052 Galactose metabolism
    ECP_4093
Enzymes [BR:ecp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     ECP_4093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4276830..4277717
Genome map
AA seq 295 aa AA seqDB search
MKTERKNEHYLALQQAFDAPWPGPVGELVTLEKGNIHLQIYPHDGARITSLKAFGSEVLR
QWQPQRRAFQYGCFPMVPWAGRLGNATLNAGGQCYSLPANKPPHALHGMACYSTWEIIDK
TADSLTLRMPLASPWPWQGEVIQTFLLENDALVLQLEVHSYADTFPASAGWHPWFAKKLT
PQNTESLQVLFDADWQEEAGSDELPTGNRISPQVGPWDDCFGFYDGVKVKLLWPGKLAMT
MTSSANSLVVFDKQPDATCINPLTQAPNAINLTPEFVTPDKPLVIETRWQFTPES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgaacgaaaaaacgagcattacctggcgctacaacaggcgtttgacgcgcca
tggcctgggcctgtaggagagttagtgacgctggaaaaaggcaatattcacctgcagatt
tatccgcatgatggtgccaggataacctcgttaaaggcatttggttctgaagtattacgc
caatggcagccgcagcgcagagcttttcagtatggctgtttcccaatggtgccgtgggca
gggcgactggggaatgcgacgctgaatgctggtgggcaatgttattctttacccgccaat
aaaccaccacatgcgttgcatggtatggcttgttactcaacgtgggaaatcatcgacaaa
acagcagattccctgactttacgtatgcccctggcttcaccgtggccctggcaaggggaa
gtgattcagacttttttgctggagaacgatgcgctggttttgcaactggaagtccattca
tatgccgatacattcccggcctccgcaggctggcatccgtggtttgcgaaaaagctgact
ccgcaaaatacagaatcgttgcaggtgctttttgatgcggactggcaagaagaagcgggt
agtgatgaactgccaactggaaatcgtatctctcctcaagttggtccctgggatgactgt
tttggtttttatgacggggtgaaggttaagttactgtggcctggtaaactcgcgatgacc
atgacctcttctgcaaacagtctggtggtatttgataaacagcccgatgccacctgtatt
aacccgctgactcaggcacctaacgcaataaatctaacgccggaatttgtgacaccagat
aagccgctggtcatcgaaactcgttggcaatttacacctgaatcttaa

DBGET integrated database retrieval system