KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4205Help
Entry
ECP_4205          CDS       T00373                                 

Definition
adenylyltransferase (EC:2.7.7.-)
Orthology
K03148  
sulfur carrier protein ThiS adenylyltransferase [EC:2.7.7.73]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ECP_4205
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    ECP_4205
Enzymes [BR:ecp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.73  sulfur carrier protein ThiS adenylyltransferase
     ECP_4205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4403738..4404493)
Genome map
AA seq 251 aa AA seqDB search
MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADD
DDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLMALQQRLTGETLKDAVAQAD
VVLDCTDNMATRQEINATCVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEP
ERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLTLRRANGC
PVCGGCNADPV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccgtgactttatgcgttatagccgccaaatcctgctcgacgatatcgctctg
gacgggcagcaaaaactgctcgacagccaggtgctgattattggtcttggcgggctgggt
acacctgctgcgctatacctggcgggggctggcgtcgggacgctggtactggcagatgac
gacgatgtgcatttaagcaatctgcaacgacaaatcctctttaccactgaagatatcgat
cgcccgaaatcacaggtcagccaacagcgactgacacagttgaatcccgacattcaactg
atggcattacaacaacgattaacgggtgagacgttaaaagatgcggttgcacaagccgat
gtggtgctcgactgtactgacaatatggcgactcgccaggagattaatgccacctgcgtg
gcactcaacacgccgcttatcaccgccagcgcggtcggatttggcggtcagttgatggta
ctgacgccgccctgggagcaggggtgttaccgctgcctgtggccagataaccaggagcca
gaacgcaactgccgcacggcgggcgtggttggcccggtggtcggggttatgggcactttg
caggccctggaagccattaagttattaagcggtatagagacgcctgcgggagaactccga
ctgttcgacggtaaatcgagccagtggcgcagcctgacgttgcgccgcgccaacggttgc
ccggtatgtggaggatgcaatgcagatcctgtttaa

DBGET integrated database retrieval system