KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4225Help
Entry
ECP_4225          CDS       T00373                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECP_4225
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECP_4225
Enzymes [BR:ecp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ECP_4225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4428002..4429306
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAV
VERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADL
ITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaattgaagaattacagaaagagtggactcaaccgcgttgg
gaaggcattactcgcccgtacagcgcggaagatgtggtgaaattacgcggttcagtcaat
ccggaatgcaccctggcgcaactgggtgcggcgaaaatgtggcgtctgctgcacggcgag
tcgaaaaaaggctacatcaacagcctcggtgcactgactggcggtcaggcgctgcaacag
gcgaaagcgggtattgaagcagtctatctgtcgggatggcaggtagcggcggacgctaac
ctggcggccagcatgtatccggatcagtcgctctatccggcaaactcggtgccagcggtg
gtggagcggatcaacaatactttccgccgtgcggatcagatccaatggtccgcgggcatt
gagccgggcgatccgcgctatgtcgattacttcctgccgatcgtcgccgatgcggaggcc
ggttttggcggtgtactgaatgcctttgaactgatgaaagcgatgattgaagccggtgca
gcggcagttcacttcgaagatcagctggcatcagtgaagaaatgtggtcacatgggcggc
aaagttttggtgccaactcaggaagctattcagaaactggtcgcggcgcgtctggcagct
gatgtgacgggcgttccaaccctgctggttgctcgtaccgatgccgatgcggcggatctg
attacctccgattgcgacccatatgacagcgaatttattactggcgagcgtaccagtgaa
ggcttcttccgtactcatgcgggtattgagcaagcgatcagccgtggcctggcgtatgcg
ccatatgctgacctggtatggtgtgaaacctccacgccggatctggaactggcgcgtcgc
tttgcacaagccatccacgcgaaatatccgggcaaactgctggcttataactgctcgccg
tcgttcaactggcagaaaaacctcgacgacaaaactattgccagcttccagcagcagctg
tcggatatgggctacaagttccagttcatcaccctggcaggtatccacagcatgtggttc
aacatgtttgacctggcaaacgcctatgcccagggcgagggtatgaagcactatgttgag
aaagtgcagcagccggaatttgccgccgcgaaagatggctataccttcgtatctcaccaa
caggaagtgggtacaggttacttcgataaagtgacgaccattattcaaggtggcacgtct
tcagttaccgcgctgaccggctccaccgaagaatcgcagttctaa

DBGET integrated database retrieval system