KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4275Help
Entry
ECP_4275          CDS       T00373                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECP_4275
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECP_4275
  Amino acid metabolism
   00310 Lysine degradation
    ECP_4275
Enzymes [BR:ecp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ECP_4275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4483619..4484773
Genome map
AA seq 384 aa AA seqDB search
MIEITVPVLPESVTEGTLTTWCKQEGEHVKRDDVIAELETDKVILEIPAPHDGVLSNIIV
SEGSTVTSAQLLAHLKPQAVIEETVTPVTETLAMPSARLEAQRSGVELADVAGSGRNGRI
LKEDVQRVTPAPVIQPERVAEIAPAKPLTPGARQERREPMSRLRQRIAERLLASQQNNAI
LTTFNEVNMQSVMDLRARWKDRFAEKHGVKLGFMSFFVKAVTRALERFPVVNASVDGNEI
IWRDYCDIGIAVSSNRGLVVPVLRNAQSLSLVEIERQIAEYATQARNGKLPLEALQGGTF
SITNGGTFGSMMSTPIINPPQSAILGMHAITPRPVAENGQVVIRPMMYLALSYDHRIIDG
QEAVQALVAIRELLESPEQLLLDL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattactgtccctgtattaccggaatctgtcacggaaggcacgctgacaacc
tggtgtaaacaagaaggcgagcacgtaaaacgcgatgatgtgattgccgagctggaaacc
gataaagtcattctggaaataccggccccgcacgatggcgtgttaagcaatattatcgtc
agcgaaggtagcacggtcacgtccgcgcaactgttggcgcatcttaagccgcaagctgtc
atagaagaaaccgtcacaccagtcaccgaaaccctggcgatgccttccgcacggctggag
gcacagcgtagtggtgtcgaacttgctgacgttgcggggagcgggagaaatggacgtatc
ctgaaagaggatgtacagcgcgttactcctgcaccagtcattcagcctgaacgggtggcg
gagatcgcgccagctaaacccttgacaccgggtgctcgtcaggaacgtcgtgagccgatg
tcgcgcttacgtcagcggattgctgagcgtctgctggcttcccaacaaaataacgccatt
cttaccacattcaacgaagtaaacatgcagagcgtgatggatttacgcgcccgctggaaa
gatcgttttgccgagaagcacggcgtgaagctgggctttatgtccttctttgttaaggcc
gttacccgggcgctggagcgcttccctgtagtgaatgccagcgttgatggcaacgagatt
atctggcgtgattattgcgatatcggcattgcagtgagcagcaaccgcggcctggtagtg
cctgtgttacgcaatgcgcaatcactctctttggtggaaattgaacggcaaattgccgaa
tacgccacacaggcacgcaatggcaaattgccgctggaggcgttacagggcggcacgttc
tctatcaccaacggcggtacttttggttcgatgatgtcaacgccaatcattaacccgccg
cagtcggccattcttgggatgcatgccatcacgccgcgcccggtcgcagaaaacggccag
gttgttattcgtcccatgatgtaccttgctctcagctatgaccatcgcattatcgatggt
caggaagccgtgcaggcattggtggcaatacgtgagctactggaatcaccggaacaactg
ttgctggatctttaa

DBGET integrated database retrieval system