KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4277Help
Entry
ECP_4277          CDS       T00373                                 

Definition
(RefSeq) succinyl-CoA synthetase beta chain (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECP_4277
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECP_4277
   00640 Propanoate metabolism
    ECP_4277
   00660 C5-Branched dibasic acid metabolism
    ECP_4277
Enzymes [BR:ecp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ECP_4277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4486225..4487394
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKSLLAGMGMPCPKEIAIQQISQLADAWQHIACPSKGAVLKAQVHAGGRGKAG
GVKVLKQLPEAQAFVQQMLGSQLVTYQTGPEGQYVSSILLCENIYPVRQELYFGMVVDRE
SQRVTFIVSPEGGVEIEKVAHETPEKISSVSIDPLTGVQPCHIREMFAVLQLEHGLFAAF
SRLVNQAWKAFNELDFALLEINPLVLRETGEFMCADAKVSLDDNALYRHPELQVLRDETQ
EDPRESQAAKLDLNYVSLDGNIGCMVNGAGLAMATMDIIKLYGEQPANFLDVGGGATQER
VSEAFRLIVSDSKVKAILVNIFGGIVRCDMIARAIIHALNEARITLPVVVRLSGNNAAEG
QRLLAESGLTVEAVDSLDDAAKRIIALLN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaggccaaatcgttactggctggcatggggatgccgtgtcca
aaagagatagccatccaacagatttcgcaactggcagatgcctggcaacatattgcttgc
ccgagtaaaggcgcggtacttaaagcgcaggtacatgctggtgggcgcggtaaagctggc
ggcgtaaaagtgcttaagcagctgccggaagcacaggcttttgtacagcaaatgttggga
tcgcaactggtgacttatcagaccgggccagaaggacagtatgtcagcagtattttactg
tgcgaaaacatttatccggtacgccaggaactctattttggcatggtggtggatcgtgaa
agccagcgggtcacgtttattgtcagcccggaaggtggtgtggaaattgaaaaagtcgcc
catgagacaccggagaaaatcagcagtgtcagcattgatccactgacaggcgtgcagcct
tgccatatccgcgaaatgtttgctgttctgcaactggaacacggactatttgctgccttt
agtcgcctggttaatcaggcgtggaaagcctttaacgaactggatttcgccctgctggaa
attaaccctctggtgttgcgggaaacgggcgaatttatgtgtgcagacgcgaaagtatcg
ctggatgataacgcgctgtatcgtcacccggaactccaggtgctacgtgatgaaacccag
gaagatccacgcgaaagccaggcagcgaagcttgatcttaattatgtctcgctggacgga
aatatcggctgcatggtcaatggtgcagggctggctatggcaaccatggacatcatcaag
ctatacggtgaacaacccgcaaacttcctggatgttggcggtggcgcaacccaggagcgc
gtcagtgaagcctttcggctgattgtttccgacagcaaagtgaaagccattctggttaat
atttttggtgggattgtccgttgcgacatgatcgccagagccattattcatgctctgaat
gaggcccgtatcaccctgcctgtcgtggtgcgtctctccggtaataacgctgccgaaggg
cagcggttactggcagaaagtggcctgacggtggaagccgtcgattctctggatgatgcc
gcgaaacgcatcattgcgttactgaattaa

DBGET integrated database retrieval system