KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4301Help
Entry
ECP_4301          CDS       T00373                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00010  Glycolysis / Gluconeogenesis
ecp00620  Pyruvate metabolism
ecp00640  Propanoate metabolism
ecp00680  Methane metabolism
ecp01100  Metabolic pathways
ecp01110  Biosynthesis of secondary metabolites
ecp01120  Microbial metabolism in diverse environments
ecp01130  Biosynthesis of antibiotics
ecp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECP_4301
   00620 Pyruvate metabolism
    ECP_4301
   00640 Propanoate metabolism
    ECP_4301
  Energy metabolism
   00680 Methane metabolism
    ECP_4301
Enzymes [BR:ecp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ECP_4301
Lipid biosynthesis proteins [BR:ecp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ECP_4301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABG72249
Position
complement(4511056..4513014)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINAPDTFWGEQGKILDWITPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDL
VEQASAQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgcaccagataccttctggggc
gaacagggaaaaattctcgactggatcacaccgtaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatattagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcgaactgggcattaaaaaaggtgacgtagttgcgatttatatgccg
atggtaccggaagccgcggtcgcgatgctggcctgcgcccgcattggcgcggtacattcg
gtgattttcggcggcttctcgccggaagccgttgccggacgcattatcgactccagttca
cgactggtgatcacttccgacgaaggtgtgcgtgccgggcgtagtattccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggtggaaaaattgactggcaggaagggcgcgacctgtggtggcacgacctg
gttgagcaagccagcgctcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctatacctccggttctaccggtaagccaaaaggcgtgctgcacactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggcgatatc
tactggtgcaccgccgatgtgggctgggttaccggacacagttatttgctgtatggcccg
ctggcctgcggcgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcgcaggtggtggacaagcatcaggtcaatattctctataccgcgcccacggcg
attcgcgcgctgatggcggaaggcgataaagcgatcgaaggcaccgaccgttcgtcgctg
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaag
aagatcggcaacgagaaatgcccggtggtcgacacctggtggcagaccgaaactggcggt
ttcatgatcacgccactgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccagcgctggtcgataacgaaggtaacccgctggagggggccacc
gaaggcagtctggtgatcaccgactcctggccgggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgagcagacctacttctccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagatggctattactggatcaccgggcgcgtggacgacgtgctg
aacgtctccggtcaccgcctggggacggcagagattgagtcggcgctggtggcgcatccg
aaaattgccgaagccgctgtggtcggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggccatcgcgatgccatcgtaa

DBGET integrated database retrieval system