KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4446Help
Entry
ECP_4446          CDS       T00373                                 

Definition
primosomal replication protein N
Orthology
K02686  
primosomal replication protein N
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ecp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4655049..4655363
Genome map
AA seq 104 aa AA seqDB search
MTNRLVLSGTVCRTPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQ
AITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccgtctggtgttgtccggcaccgtgtgcaggactccccttcgaaaggtcagt
ccatcaggaattcctcactgccagttcgtgcttgagcatcgttctgtgcaggaggaagcc
ggctttcaccggcaggcgtggtgccaaatgcccgttattgttagcggacacgaaaaccag
gccattactcacagtataacggtcggcagtcgcataaccgttcaggggttcatttcatgc
cataaggcaaagaacggactgagcaaaatggttttgcatgccgagcagattgaattgata
gattctggagactag

DBGET integrated database retrieval system