KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4468Help
Entry
ECP_4468          CDS       T00373                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ECP_4468
Enzymes [BR:ecp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ECP_4468
Transfer RNA biogenesis [BR:ecp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ECP_4468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4675334..4676074
Genome map
AA seq 246 aa AA seqDB search
MLDQVCQLARNAGDAIMQVYDGTKPMDVVSKADNSPVTAADIAAHTVIMDGLRTLTPDIP
VLSEEDPPGWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDHGKPILGVVYAPVM
NVMYSAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHADAELKEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHDWQGKPLDYTPRESFLNPG
FRVSIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaagtatgccagcttgcacggaatgcaggcgatgccattatgcaggtctac
gacgggacgaaaccgatggacgtcgtcagcaaagcggacaattctccggtaacggcagcg
gatattgccgctcacaccgttatcatggacggtttacgtacgctgacaccggatattccg
gtcctttctgaagaagatcctcccggttgggaagtccgtcagcactggcagcgttactgg
ctggtagacccgctggatggtactaaagagtttattaaacgtaatggcgaattcaccgtt
aacattgcgctcatcgaccacggtaaaccgattttaggtgtggtgtatgcgccggtaatg
aacgtaatgtacagcgcggcagaaggcaaagcctggaaagaagagtgcggtgtgcgcaag
cagattcaggtccgcgatgcgcgcccgccgctggtggtaatcagccgttcccatgcagat
gcggagctgaaagagtatctgcaacagcttggcgaacatcagaccacgtccatcggctct
tcgctgaaattctgcctggtggcggaaggacaggcgcagctgtacccgcgtttcgggcca
acgaatatttgggataccgccgctggtcatgctgtggctgcagctgccggagcgcacgtt
cacgactggcagggtaaaccgctggattacactccgcgcgagtcgttcctgaatccgggg
ttcagagtgtctatttattaa

DBGET integrated database retrieval system