KEGG   Escherichia coli O81 ED1a (commensal): ECED1_0406Help
Entry
ECED1_0406        CDS       T00827                                 

Gene name
phoA
Definition
(GenBank) bacterial alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00730  Thiamine metabolism
ecq00790  Folate biosynthesis
ecq01100  Metabolic pathways
ecq02020  Two-component system
Module
ecq_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ECED1_0406 (phoA)
   00790 Folate biosynthesis
    ECED1_0406 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECED1_0406 (phoA)
Enzymes [BR:ecq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ECED1_0406 (phoA)
Exosome [BR:ecq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECED1_0406 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecq00537]
 Enzymes
  ECED1_0406 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: CAR06616
UniProt: B7MPE4
Structure
PDB: 

Jmol
Position
422715..424130
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWQGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggactcggaaatt
actgccgcacgcaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaactggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcgcatgtgacctcgcgcaaatgctacggtccgagtgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgcc
cgtgccgatgttacgcttggcggcggcgcaaaaacctttgctgaaacggcaaccgccggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagc
gatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctattaggactg
tttgctgacggcaatatgccagtgcgctggcaaggaccgaaagcaacgtaccacggtaat
atagataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccgacc
ctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggctttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaag
gatggtaacacgttggtcatagtcaccgctgatcacgcccatgccagccagatagttgcg
ccagataccaaagctccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactccgaagaggattcacaagaacataccggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system