KEGG   Escherichia coli O81 ED1a (commensal): ECED1_0624Help
Entry
ECED1_0624        CDS       T00827                                 

Gene name
lipA
Definition
lipoyl synthase
Orthology
K03644  
lipoic acid synthetase [EC:2.8.1.8]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
Lipoic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    ECED1_0624 (lipA)
Enzymes [BR:ecq01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     ECED1_0624 (lipA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(646398..647363)
Genome map
AA seq 321 aa AA seqDB search
MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSTRIQGIKAAMR
KNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPVKLA
QTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKIETLVPDFRGRMDRAL
DILTATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGE
TNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFDEMKAEALAMGFTHAA
CGPFVRSSYHADLQAKGMEVK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacccattgtgatggaacgcggtgttaaataccgcgatgccgataagatggcc
cttatcccggttaaaaacgtggcaacagagcgcgaagccctgctgcgcaagccggaatgg
atgaaaatcaagcttccagcggactctacacgtatccagggcatcaaagccgcaatgcgc
aaaaatggcctgcattctgtctgcgaggaagcctcctgccctaacctggcggaatgcttt
aaccacggcacagcaacgtttatgatcctcggcgctatttgtacccgccgttgcccgttc
tgtgacgttgcccacggtcgcccggtagctcctgatgccaatgaaccagtgaaactggcg
cagaccattgccgatatggcgctgcgttatgtggttatcacctccgttgaccgtgatgac
ctacgcgatggcggtgcccagcactttgcggattgcattactgccattcgggaaaaaagc
ccgcaaatcaaaattgaaactctggtgccggatttccgcggtcgtatggatcgtgctctg
gatattctgactgcaacgccaccagatgtgttcaaccataacctggaaaacgtaccgcgt
atttaccgtcaggtacggcctggcgcagattacaactggtcgcttaagctgctggaacgc
tttaaagaagcgcatccggaaatcccgaccaagtctggtctgatggtgggactgggtgaa
accaatgaagaaattattgaggtaatgcgcgacctgcgccgtcatggtgtgacgatgcta
acgctggggcaatatttgcagccaagccgccatcacctgccggttcaacgttacgttagc
ccggatgagttcgacgaaatgaaagccgaagcgctggcgatgggctttacccatgctgca
tgcggtccgtttgtccgctcttcttaccacgccgatttgcaggcgaaagggatggaagtt
aagtaa

DBGET integrated database retrieval system