KEGG   Escherichia coli O81 ED1a (commensal): ECED1_0624Help
Entry
ECED1_0624        CDS       T00827                                 

Gene name
lipA
Definition
lipoyl synthase
Orthology
K03644  
lipoic acid synthetase [EC:2.8.1.8]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
Lipoic acid metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Lipoic acid metabolism [PATH:ecq00785]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(646398..647363)
Genome map
AA seq 321 aa AA seqDB search
MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSTRIQGIKAAMR
KNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPVKLA
QTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKIETLVPDFRGRMDRAL
DILTATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGE
TNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFDEMKAEALAMGFTHAA
CGPFVRSSYHADLQAKGMEVK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacccattgtgatggaacgcggtgttaaataccgcgatgccgataagatggcc
cttatcccggttaaaaacgtggcaacagagcgcgaagccctgctgcgcaagccggaatgg
atgaaaatcaagcttccagcggactctacacgtatccagggcatcaaagccgcaatgcgc
aaaaatggcctgcattctgtctgcgaggaagcctcctgccctaacctggcggaatgcttt
aaccacggcacagcaacgtttatgatcctcggcgctatttgtacccgccgttgcccgttc
tgtgacgttgcccacggtcgcccggtagctcctgatgccaatgaaccagtgaaactggcg
cagaccattgccgatatggcgctgcgttatgtggttatcacctccgttgaccgtgatgac
ctacgcgatggcggtgcccagcactttgcggattgcattactgccattcgggaaaaaagc
ccgcaaatcaaaattgaaactctggtgccggatttccgcggtcgtatggatcgtgctctg
gatattctgactgcaacgccaccagatgtgttcaaccataacctggaaaacgtaccgcgt
atttaccgtcaggtacggcctggcgcagattacaactggtcgcttaagctgctggaacgc
tttaaagaagcgcatccggaaatcccgaccaagtctggtctgatggtgggactgggtgaa
accaatgaagaaattattgaggtaatgcgcgacctgcgccgtcatggtgtgacgatgcta
acgctggggcaatatttgcagccaagccgccatcacctgccggttcaacgttacgttagc
ccggatgagttcgacgaaatgaaagccgaagcgctggcgatgggctttacccatgctgca
tgcggtccgtttgtccgctcttcttaccacgccgatttgcaggcgaaagggatggaagtt
aagtaa

DBGET integrated database retrieval system