KEGG   Escherichia coli O81 ED1a (commensal): ECED1_0786Help
Entry
ECED1_0786        CDS       T00827                                 

Gene name
ybiV
Definition
type II HAD phosphatase
Orthology
K07757  
sugar-phosphatase [EC:3.1.3.23]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(816235..817050)
Genome map
AA seq 271 aa AA seqDB search
MSVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIEFVVASGNQYYQLISFFPELKD
EISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPE
AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHIALDGIMKPVTSGF
GFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMSNAAENIK
QIARYATDDNNHEGALNVIQTVLENKPPFNL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtaaaagttatcgtcacagacatggacggtacttttcttaacgacgccaaaacg
tacaaccaaccacgttttatggcgcagtatcaggaacttaaaaagcgcggcattgagttc
gttgtcgccagcggtaatcagtattaccagcttatttcgttctttcctgagctaaaggat
gagatctcttttgtcgcggaaaacggcgcactggtttacgaacatggcaagcagttgttc
cacggcgaactgacccgacatgaatcgcggattgttattggcgagttgctaaaagataag
caactcaattttgtcgcctgcggtctgcaaagtgcatatgtcagcgaaaatgcccccgaa
gcattcgtcgcactgatggcaaaacactaccatcgcctgaaacctgtaaaagattatcag
gagattgacgacgtactgttcaagttttcgctcaacctgccggatgaacaaatcccgtta
gtgatcgacaaactgcacatagcgctggatggcattatgaaacccgttaccagtggtttt
ggctttatcgacctgattattcccggtctacataaagcaaacggtatttcgcggttactg
aaacgctgggatctgtcgccgcaaaatgtggtagcgattggcgacagcggtaacgatgcg
gagatgctgaaaatggcgcgttattcctttgcgatgagcaatgctgcggaaaacattaaa
caaatcgcccgttacgctaccgatgataataatcatgaaggcgcgctgaatgtgattcag
acggtgctggaaaataaaccgccgtttaatctttga

DBGET integrated database retrieval system