KEGG   Escherichia coli O81 ED1a (commensal): ECED1_1274Help
Entry
ECED1_1274        CDS       T00827                                 

Gene name
phoP
Definition
DNA-binding transcriptional regulator PhoP
Orthology
K07660  
two-component system, OmpR family, response regulator PhoP
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
Two-component system
Module
PhoQ-PhoP (magnesium transport) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ecq02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1275761..1276432)
Genome map
AA seq 223 aa AA seqDB search
MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHLPDIAIVDLGLPDEDGL
SLIRRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRNS
GLASQVISLPPFQVDLSRRELSINDEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYP
DAELRESHTIDVLMGRLRKKIQAQYPQEVITTVRGQGYLFELR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtactggttgttgaagacaatgcgttgttacgtcaccatcttaaagttcagata
caggatgctggtcatcaggtcgatgacgcagaagatgccaaagaagccgattattatctc
aatgaacatttacctgatattgcgattgtcgatctcggattgcctgacgaggatggtctg
tcactgattcgccgctggcgtagcaatgatgtttcactgccgattctggtattaaccgcc
cgtgagagctggcaggacaaagtcgaagtattaagtgccggtgctgatgattacgtgact
aaaccgtttcatattgaagaggtgatggcgcgaatgcaggcattaatgcggcgtaatagc
ggtctggcttcacaggtcatttcgctaccaccgtttcaggttgatctctcccgccgtgaa
ttatctattaatgacgaagtgatcaaactgaccgcgttcgaatacaccattatggaaacg
ttgatacgcaataatggcaaagtggtgagcaaagattcgttaatgctccaactctatccg
gatgcggagctgcgggaaagtcataccatagatgtactgatgggacgtctgcgcaaaaaa
atacaggcacaatatccgcaagaagtgattaccaccgttcgcggccagggctatctgttc
gaattgcgctga

DBGET integrated database retrieval system