KEGG   Escherichia coli O81 ED1a (commensal): ECED1_1274Help
Entry
ECED1_1274        CDS       T00827                                 

Gene name
phoP
Definition
(GenBank) DNA-binding response regulator in two-component regulatory system with PhoQ
  KO
K07660  
two-component system, OmpR family, response regulator PhoP
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Two-component system
Module
PhoQ-PhoP (magnesium transport) two-component regulatory system
Macrolide resistance, MacAB-TolC transporter
Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
Cationic antimicrobial peptide (CAMP) resistance, palmitoyl transferase PagP
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECED1_1274 (phoP)
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ECED1_1274 (phoP)
Two-component system [BR:ecq02022]
 OmpR family
  PhoQ-PhoP [MD:M00444]
   ECED1_1274 (phoP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1275761..1276432)
Genome map
AA seq 223 aa AA seqDB search
MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHLPDIAIVDLGLPDEDGL
SLIRRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRNS
GLASQVISLPPFQVDLSRRELSINDEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYP
DAELRESHTIDVLMGRLRKKIQAQYPQEVITTVRGQGYLFELR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtactggttgttgaagacaatgcgttgttacgtcaccatcttaaagttcagata
caggatgctggtcatcaggtcgatgacgcagaagatgccaaagaagccgattattatctc
aatgaacatttacctgatattgcgattgtcgatctcggattgcctgacgaggatggtctg
tcactgattcgccgctggcgtagcaatgatgtttcactgccgattctggtattaaccgcc
cgtgagagctggcaggacaaagtcgaagtattaagtgccggtgctgatgattacgtgact
aaaccgtttcatattgaagaggtgatggcgcgaatgcaggcattaatgcggcgtaatagc
ggtctggcttcacaggtcatttcgctaccaccgtttcaggttgatctctcccgccgtgaa
ttatctattaatgacgaagtgatcaaactgaccgcgttcgaatacaccattatggaaacg
ttgatacgcaataatggcaaagtggtgagcaaagattcgttaatgctccaactctatccg
gatgcggagctgcgggaaagtcataccatagatgtactgatgggacgtctgcgcaaaaaa
atacaggcacaatatccgcaagaagtgattaccaccgttcgcggccagggctatctgttc
gaattgcgctga

DBGET integrated database retrieval system