KEGG   Escherichia coli O81 ED1a (commensal): ECED1_2296Help
Entry
ECED1_2296        CDS       T00827                                 

Definition
Type III restriction-modification system site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Brite
Enzymes [BR:ecq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     ECED1_2296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2242621..2245581
Genome map
AA seq 986 aa AA seqDB search
MKLHFESDLTYQQNAITSVCDLFVGQEKWESEMTVLAPAQGALSFEGATGSMPVNPQIPE
DDVLLKNLNNVQLKNQLPPSPVLDSHDFTVEMETGTGKTYVYLRTMLELNKRYGMSKFII
VVPSVAIKEGVYKTLQITEEHFKSLYAGVPYEYYLYDSAKPADVRNFATSSVMQIMVMTV
GAINKKDVNKLYQSSEKTTVDDLDKPIDLIRATRPIIIVDEPQSVDGGLNGAGKTALDAM
HPMFTLRYSATHVHKHHMVYRLDAIDAYNQKLVKQIEVAGLEVQNASNSPYVKLVSINSK
KNSISATVIVDIADKKGNVTRSEITVHDGMTLDDETGRDIYQGYRISEIRTGKEGYLTLE
TPSNTYYMQVGDVVGDIDPMLIQRHMIRRTIREHLDKELRLNSQQIKVLTLFFIDKVDFY
RQTNEEGLREPGEYARIFEEEYLKAIKSPAYKDLLPSHPEHAKDVHDGYFSIDKKGGWAE
TTESNNAGRENAERGYNLIMKNKEKLLSFSNPVRFIFSHSALKEGWDNPNVFQICSLREM
GSERERRQTLGRGLRLCVNQEGERVRDDSINILTVIASENYEAYAERLQSEIENETGIRF
GIIEKDAFAHLIASDYPQGVGIAGSHEIWAELQTEGYLEKSGKITKALKEALFKNTFAVG
EKYALLQEQIETILRKSAGRLNINNADERKTIKYRKEVLNSPEFEALWQRICQKTLYRLA
FDEDELIKSCTKSLSEMQPVAKAMVSFSKATIKQSQSGLDVKAKTNGTTSSVIDVAEQPL
PDILGVLQEKTGLTRRSLCTILKESEKLADFAKNPQQFISEAIGRINYCKRLSIVDGIKY
YPLKGEVYAQSLFMDKELTGYARNLFETSSKSVYEYVPKDSEVESRFAQELEEQDEVKLY
LKLPGWFKIPTPLGTYNPDWALVIEDNGEEHIYFVVETKSKHIGLGHEEDAKIACGTAHF
SALKEEQSNAAKYVRATDLTEIMGSL
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacattttgaatctgaccttacctatcagcaaaacgccataacttcggtctgt
gatttgtttgtgggacaggagaagtgggagagcgaaatgactgtgctggccccagctcag
ggtgcactctcatttgaaggcgcaacaggttcaatgcctgtaaacccacagatacccgaa
gatgatgttctgctgaaaaacctgaacaatgttcagttaaaaaaccagcttccaccttca
cctgtgctcgacagccatgattttactgtcgagatggaaacagggacaggtaagacgtat
gtttatcttcgcaccatgcttgagttgaataaacgatatggcatgagcaaatttatcatc
gtagttccttccgttgccatcaaggaaggcgtttataaaacactacaaattactgaagag
catttcaaaagcctgtatgcgggagttccatacgaatactatctgtatgattcggcaaaa
cctgcggatgttcgaaattttgcaaccagttctgttatgcagatcatggtaatgactgtg
ggtgcgattaacaaaaaagatgttaacaagctctatcagtccagtgaaaaaacaactgtg
gacgatctggataagcccattgatttaatccgtgctacacgtccaattattattgtcgat
gaaccgcaaagtgttgatggtggcttaaatggtgcaggtaaaaccgcacttgatgctatg
cacccaatgtttaccttacgctattcagcgacacatgtgcataaacatcatatggtgtat
cgcctcgatgccattgatgcttacaatcagaaactggtgaaacaaatcgaagttgccggg
cttgaagtccagaatgcaagcaatagcccctatgtaaaactggtcagtattaacagtaag
aagaatagcattagcgcgactgttattgttgatatagccgataaaaaagggaatgtaact
cgttctgaaattaccgtgcatgacggtatgacacttgatgacgaaacggggcgtgatatt
tatcagggatacaggataagtgagatccgcacgggcaaagaaggctatctgacactggag
acgccttctaatacctactatatgcaagtgggtgatgtcgtgggtgatattgacccgatg
ctcatccagcgtcatatgattaggcgtacaattcgtgaacatcttgataaagaacttcgc
ctgaattcccagcaaatcaaggttctcaccctgttcttcattgataaggttgatttctat
cgccagactaatgaagaaggacttcgtgaaccgggtgaatatgctcgtatctttgaagaa
gaatatctaaaagcgatcaaaagccccgcatataaagatttgctcccttctcatccagaa
catgctaaagacgttcatgatggttatttctccattgataaaaaaggtggatgggctgaa
acaaccgaaagcaataatgcaggccgcgaaaatgcggaacgcggttataacctcatcatg
aaaaataaagagaagcttttgagtttctcgaatccagtgaggtttattttttcacactct
gctttgaaagaaggctgggataaccccaatgtattccagatctgtagccttcgagagatg
ggaagtgaacgagaacgtcgtcaaacattagggcgtggtcttcgcctgtgtgttaaccaa
gagggtgaacgtgttcgtgatgacagcattaacattctgactgtaattgccagtgaaaat
tatgaagcctatgctgaacgactacagagtgaaattgagaacgaaacaggcatccgtttt
ggtatcatcgaaaaagatgcgtttgcacatctgatcgcctctgattacccgcaaggtgta
ggtatcgcaggttcacatgagatttgggctgaactccagactgaaggttatctggaaaag
tcgggaaaaataactaaagcactgaaagaagcccttttcaaaaacacttttgctgttggc
gagaagtacgccttactacaggaacaaattgaaactatcctacgtaaatcagcagggcga
ctcaatataaacaatgctgatgagcgtaaaacaatcaaataccggaaagaagtcttaaac
agcccggaattcgaagcgttatggcagcgcatttgtcaaaaaacgctgtaccgtctggca
tttgatgaagatgaattgattaaatcctgtacgaaatcactttctgaaatgcagcctgta
gcgaaagcaatggtcagtttcagcaaagcaacaatcaaacaaagtcagtcaggtcttgat
gttaaggcgaagactaatggtacgacaagctctgttattgatgttgcagagcagccacta
ccagatattcttggtgttctacaggaaaaaaccggactgacaagacgcagtttatgcacc
atcctgaaagagagtgaaaaacttgctgattttgctaaaaatccacagcagttcatcagt
gaagctataggccgaatcaactactgtaaacgcctgtcaattgttgatggtattaaatat
tatccactaaaaggagaggtgtatgcgcaaagtctctttatggataaggagctaacagga
tatgcccgcaatcttttcgaaacctcgtctaagtcagtttacgaatatgttcctaaagat
tctgaagtcgaaagtcgtttcgctcaagaactcgaagaacaggatgaagttaagctttat
ctgaagcttcccggctggtttaaaatcccgacaccattagggacttataatcctgactgg
gccttagttattgaagacaatggtgaagaacatatttactttgttgtagagacaaaaagt
aaacacattggtcttggtcatgaagaagatgcgaagatagcctgtggaactgcgcatttt
agtgccctaaaagaagaacagagtaatgcagcaaaatatgttagagctacagatcttaca
gaaataatgggtagcctctaa

DBGET integrated database retrieval system