KEGG   Escherichia coli O81 ED1a (commensal): ECED1_2369Help
Entry
ECED1_2369        CDS       T00827                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase and histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00340  Histidine metabolism
ecq01100  Metabolic pathways
ecq01110  Biosynthesis of secondary metabolites
ecq01230  Biosynthesis of amino acids
Module
ecq_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ECED1_2369 (hisD)
Enzymes [BR:ecq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ECED1_2369 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CAR08555
UniProt: B7MWT9
Structure
PDB: 

Jmol
Position
2300608..2301912
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDSVKARGDDALREYSAKFDK
TTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLNGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPAADMARRVAEAVERQLAELPRAETARQ
ALSASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKVGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaagcattacccgcactgttaacgatattctc
gatagcgtgaaagcacgcggtgatgacgccctgcgggaatacagcgcgaagtttgataaa
accacggttaccgcactgaaggtgtctgctgaggaaattgccgccgctagcgaacgcctg
agcgacgagctaaaacaggcgatggcagtggcagtaaagaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgccagcaggtc
acgcgcccggtcgcttcagttgggttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcaactccggcgcgtattgcgggctgtaaaaaagtggtgttgtgc
tcaccgccgccgattgccgatgagatcctttatgcggcgcagctgtgcggtgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcgctggcgtttggtacggaatctgtg
ccgaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcgaaacgtcag
gtgagccagcgtctgaacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgctgacagcggcgctacgccggatttcgtggcttctgatttgctttctcaggct
gaacacggcccagactcacaggtgattttactgacgcccgctgctgatatggcgcgtcgc
gttgccgaggccgtcgaacgccagttggcagaactgccgcgtgccgaaaccgcccgccag
gcactgagcgccagccgcctgatcgtgactaaagatttagcgcagtgcgtagagatctcc
aaccagtacggcccggagcacctgatcattcagacccgcaacgcccgcgaactggtcgat
ggcattaccagtgccggttcggtatttctgggtgactggtcaccggaatcggcaggtgat
tacgcctccggaaccaaccatgttctaccgacttacggctacaccgccacctgttccagc
ctcggactggcggatttccagaagcggatgaccgtgcaggaactctcgaaagtaggtttc
tccgcgctggcttcgaccattgaaacactggccgccgccgagcgcctgaccgcccacaaa
aatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system