KEGG   Escherichia coli O81 ED1a (commensal): ECED1_2527Help
Entry
ECED1_2527        CDS       T00827                                 

Gene name
ydfQ
Definition
putative membrane-associated lysozyme; Qin prophage
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Brite
Enzymes [BR:ecq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECED1_2527 (ydfQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2473105..2473638)
Genome map
AA seq 177 aa AA seqDB search
MNAKIRYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTMAYRDGAGIWTICRGATRVDG
KPVIPGMKLSKGKCDRVNAIERDKALAWVEKNIRVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRINAGDRRGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaaatcagatacggcctgtcggctgccgttctggcgctgattggtgcaggg
gcgtctgcgcctgaaatcctcgaccagtttcttgacgaaaaagaaggtaaccacaccatg
gcataccgtgatggtgcggggatctggaccatctgccgtggagccacccgggtggatggt
aagcctgttattcctggcatgaagctgtcgaagggaaaatgcgaccgggttaacgccatt
gagcgtgataaagcgctggcgtgggtggagaaaaacatcagagtgccgctgaccgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggtcccggtaagtgtttcccg
tcgacgttttataaacgaattaatgctggtgatcgcaggggagcatgtgaggcgattcgc
tggtggattaaggacggtggcagggactgccgtattcgctcaaataactgttacggtcag
gtatcccggcgagaccaggagagcgcgctggcgtgctggggaatcgacagataa

DBGET integrated database retrieval system