KEGG   Escherichia coli O81 ED1a (commensal): ECED1_2835Help
Entry
ECED1_2835        CDS       T00827                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00010  Glycolysis / Gluconeogenesis
ecq00052  Galactose metabolism
ecq00500  Starch and sucrose metabolism
ecq00520  Amino sugar and nucleotide sugar metabolism
ecq00521  Streptomycin biosynthesis
ecq01100  Metabolic pathways
ecq01110  Biosynthesis of secondary metabolites
ecq01120  Microbial metabolism in diverse environments
ecq01130  Biosynthesis of antibiotics
ecq01200  Carbon metabolism
Module
ecq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECED1_2835 (glk)
   00052 Galactose metabolism
    ECED1_2835 (glk)
   00500 Starch and sucrose metabolism
    ECED1_2835 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ECED1_2835 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECED1_2835 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ECED1_2835 (glk)
Enzymes [BR:ecq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECED1_2835 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: CAR09012
UniProt: B7MY46
Structure
PDB: 

Jmol
Position
complement(2783204..2784169)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggttattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttactgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtagaaggtaagcctattgcggtttacggtgccggaacagggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccaggagaaggcggtcac
gttgattttgcgccgaatagtgaagaagagggcattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggaacgcgtgctttctggccctggactggtgaatttgtatcgc
gcaattgttaaagccgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgcgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggtggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgcgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctctaa

DBGET integrated database retrieval system