KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3253Help
Entry
ECED1_3253        CDS       T00827                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECED1_3253 (fucA)
Enzymes [BR:ecq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ECED1_3253 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3190482..3191129)
Genome map
AA seq 215 aa AA seqDB search
MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEANLEKALWLAHEVEVLAQL
YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaataaacttgctcgtcagattattgacacttgcctggaaatgactcgcctg
gggctgaaccaggggacagcgggtaacgtcagtgtacgttatcaggatgggatgctgatt
acgcctacaggtattccatatgaaaaactgacggagtcgcatattgtctttattgatggc
aacggcaaacatgaggaaggaaaactcccctcaagcgagtggcgtttccatatggcggcc
tatcaaagcagaccggatgccaacgcggttgttcacaatcatgccgttcattgtacggca
gtttccattcttaaccgaccgatccccgcgattcactacatgattgcggcggctggcggt
aattctattccttgcgcgccttatgcgacctttggaacacgcgaactttctgaacatgtt
gcgctggctctcaaaaatcgtaaggcaactttgttacaacatcatgggcttatcgcttgt
gaggcgaatctggagaaagcgttatggctggcgcatgaagttgaagtgctggcacaactt
tacctgacgaccctggcgattacggacccggtgccagtgctgagcgatgaagagattgcc
gtagtgctggagaaattcaaaacctacgggttacggattgaagagtaa

DBGET integrated database retrieval system