KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3618Help
Entry
ECED1_3618        CDS       T00827                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECED1_3618 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECED1_3618 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ECED1_3618 (glcB)
Enzymes [BR:ecq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECED1_3618 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3545763..3547934)
Genome map
AA seq 723 aa AA seqDB search
MSQTITQGRLRIDANFKRFVDEEVLPGVELDAAAFWHNVDEIVHDLAPENRQLLAERDRI
QAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPDHVTVETTGIDSEITSQAGPQLVVP
AMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIAWVRRFLDESLPL
ENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDTAALTCILLKNNGLHIEL
QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQE
KMEKNGRQIVRKLNDDRQYTAADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEG
ILDGVMTGAIALYDLKVQKNSRTGSVYIVKPKMHGPQEVAFANKLFSRVETMLGMAPNTL
KMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTP
WIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTA
ATLHALHYHQTNVQSVQANIAQTEFNAEFEPLLDDLLTIPVAENANWSAQEIQQELDNNV
QGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQHIANWLRHGILTKDQVQASL
ENMAKVVDQQNAGDPAYRPMVENFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREK
ENH
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccataacccagggccgtttacgcattgacgccaattttaaacgttttgtg
gatgaagaagttttgcctggcgtggaactggatgctgccgcgttctggcacaatgttgat
gagatcgttcacgatctggcgccagagaatcgtcagttgctggcagagcgcgatcgcatt
caggcggcgcttgatgagtggcatcgcagcaatccggggccggtaaaagataaagcggcc
tataaatctttcctgcgtgaactgggctacctggtgccacagcctgaccacgtgacggtg
gaaaccacgggcatcgacagcgaaatcaccagtcaggcggggccacagttggtggttccg
gcgatgaacgcccgctacgcgctgaacgcggcgaacgctcgctggggctcactgtacgat
gcgttatacggcagcgacatcatcccgcaggaaggggcgatggtcagcggctacgatccg
cagcgtggtgagcaggttatcgcctgggttcggcgtttcctcgatgaatcactaccgctg
gaaaacggcagctatcaggatgtggtggcgtttaaggtggtcgataaacaattacgcatc
cagttgaaaaatggtaaagaaaccacgttacgtactccagcacagtttgtcggttaccgt
ggcgatactgctgcgctgacctgcattttgctgaaaaataacggcctgcatattgagcta
caaatcgatgccaacgggcggattggcaaagacgatccggcgcacatcaacgatgttatc
gtcgaagcggccatcagtaccattctcgactgcgaagattcggttgcggcggttgatgcg
gaagataaaatcctgctgtaccgcaacctgctgggcctgatgcaggggactctgcaagag
aaaatggagaagaacggtcggcaaatcgtgcgtaaactgaatgacgatcgtcagtacact
gccgccgatggatctgaaatttctctgcacggacgctcgttgctgtttatccgcaacgtg
gggcatttgatgaccattcctgtgatttgggacagcgaaggcaatgaaatcccggaaggc
attcttgatggcgtcatgactggcgcgattgccctctatgatttaaaagtgcagaaaaac
tcgcgcactggcagcgtctatattgtgaaaccgaaaatgcacggtccgcaggaagtggcg
ttcgccaacaaactgttttcccgcgttgagacaatgctcggtatggcaccgaataccctg
aaaatgggcattatggatgaagaacgccggacctcgctgaacttgcgtagctgtatcgct
caggcgcgcaaccgcgtggcgttcatcaataccggtttcctcgaccgtaccggcgatgaa
atgcattcggtgatggaagcgggcccgatgctgcgtaaaaaccagatgaaatcgacgccg
tggatcaaagcctacgaacgtaataacgtgctttccggtctgttctgtgggctacgtgga
aaagcgcaaatcggtaaaggcatgtgggcaatgccggacctgatggcagacatgtacagc
cagaagggcgaccaattgcgtgccggggcaaacacggcctgggttccgtcgccaactgcc
gctacgctccatgcgctgcactaccaccaaaccaacgtacagagcgtgcaagccaacatt
gcccagaccgagttcaatgctgaatttgaaccgctgctggacgatctgctgactattccg
gttgctgaaaacgctaactggtcggcgcaagagatccaacaagagctggataacaacgtg
caggggattctggggtacgtggtgcgttgggtggagcaggggattggttgttcaaaagtg
ccggatattcacaacgtggcgttgatggaagaccgcgcaacgctgcgtatctccagccag
catatcgccaactggttacgtcacggtattctgaccaaagatcaggtgcaggcctcgctg
gagaatatggcgaaagtggttgatcagcaaaacgctggcgatccggcttatcgtccaatg
gtggagaatttcgctaactcgtgtgcttttaaagctgccagcgatttgatcttcctcggc
gtgaaacagccaaacggctataccgaaccgttattacacgcatggcgtttacgcgaaaaa
gaaaatcattaa

DBGET integrated database retrieval system