KEGG   Escherichia coli O81 ED1a (commensal): ECED1_4086Help
Entry
ECED1_4086        CDS       T00827                                 

Gene name
glpD
Definition
glycerol-3-phosphate dehydrogenase (EC:1.1.5.3)
Orthology
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ecq00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3993825..3995330
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIMRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARREKG
LWIVEAEDIDTGKKYTWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNTHF
KKQLNRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDEDGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGAISDLGENFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNAD
QQSRVSQWLMEYTQQRLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctactgaaaatggccccgcat
atcgccttcccgatgcgttttcgcctgccgcatcgtccgcatctacgcccggcgtggatg
attcgtattggtctgtttatgtacgatcatctgggtaaacgcaccagcctgccgggatca
accggtttgcgttttggcgcaaactcagtgttaaaaccggaaattatgcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggtg
cgtaaaggcggtgaagtgcttactcgtactcgtgccacgtctgctcgccgcgaaaaaggc
ctgtggattgtggaagcggaagatatcgataccggcaaaaaatatacatggcaggcgcgc
ggcctggttaatgctaccggcccgtgggtgaaacaatttttcgacgacgggatgcatctg
ccttcaccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgtgtgcat
acccagaagcaagcctacattctgcaaaacgaagataaacgtattgtcttcgtgatcccg
tggatggacgagttttccatcatcggcaccaccgatgtggaatacaaaggcgatccaaaa
gcagtgaagattgaagagagtgaaatcaattacctgttgaaagtgtataacacgcacttt
aaaaagcagttaaaccgggacgatatcgtctggacctactccggcgtgcgtccgctatgt
gatgatgagtccgactcgccacaggccattacccgtgattacacccttgatatccatgat
gaagacggcaaagccccgctgctgtcggtattcggcggtaagctgaccacctaccgcaaa
ctggcggagcacgcgctggaaaaactgacgccatattatcagggcattggtccggcgtgg
acgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgtgacgattacgccgcc
cgcctgcgccgccgttacccgttcctgaccgaatcgctggcacgtcactacgcgcgcact
tacggcagcaacagcgaactgttgctcggcaatgcaggggcgataagcgacctcggtgaa
aatttcggtcatgagttctacgaagcggagctgaaatatctggtcgaccacgaatgggtc
cgccgcgccgacgatgccctgtggcgtcgcacgaaacaaggcatgtggctaaatgcggat
caacaatctcgtgtgagtcagtggctgatggaatatacgcagcagaggttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system