KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0004Help
Entry
ECIAI1_0004       CDS       T00828                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00260  Glycine, serine and threonine metabolism
ecr00750  Vitamin B6 metabolism
ecr01100  Metabolic pathways
ecr01110  Biosynthesis of secondary metabolites
ecr01120  Microbial metabolism in diverse environments
ecr01230  Biosynthesis of amino acids
Module
ecr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ecr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECIAI1_0004 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ECIAI1_0004 (thrC)
Enzymes [BR:ecr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ECIAI1_0004 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAQ96895
Structure
PDB: 

Jmol
Position
3733..5019
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
RKLMMNHQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcacaacgagcaggtcagctttgcgcaagccgtaacc
caggggttgggcaaaaatcaggggctgttttttccgcatgacctgccggaattcagcctg
actgaaattgatgagatgctgaagctggattttgtcacccgcagtgcgaagatcctctcg
gcgtttattggtgatgaaatcccgcaggaaatcctggaagagcgcgtgcgcgcggcgttt
gccttcccggctccggtcgccaatgttgaaagcgatgtcggttgtctggaattgttccac
gggccaacgctggcatttaaagatttcggcggtcgctttatggcacaaatgctgacccat
attgcgggcgataagccagtgaccattctgaccgcgacctccggtgataccggagcggca
gtggctcatgctttctacggtttaccgaatgtgaaagtggttatcctctatccacgaggc
aaaatcagtccactgcaagaaaaactgttctgtacgttgggcggcaatatcgaaactgtt
gccatcgacggcgatttcgatgcctgtcaggcgctggtgaagcaggcgtttgatgatgaa
gaactgaaagtggcgctggggttaaactcagctaactcgattaacatcagccgtttgctg
gcgcagatttgctactactttgaagctgttgcgcagctgccgcaggaagcgcgcaaccag
ctggttgtctcggtgccaagcggaaacttcggcgatttgacggcgggtctgctggcgaag
tcactcggtctgccggtgaaacgttttattgctgcgaccaacgtgaacgataccgtgcca
cgtttcctgcacgacggtcagtggtcacccaaagcgactcaggcgacgttatccaacgcg
atggacgtgagtcagccgaacaactggccgcgtgtggaagagttgttccgccgcaaaatc
tggcaactgaaagagctgggttatgcagccgtggatgatgaaaccacgcaacagacaatg
cgtgagttaaaagaactgggctacacctcggagccgcacgctgccgtagcgtatcgtgcg
ctgcgtgaccagttgaatccaggcgaatatggcttgttcctcggcaccgcgcatccggcg
aaatttaaagagagcgtggaagcgattctcggtgaaacgttggatctgccaaaagagctg
gcagaacgtgctgatttacccttgctttcacataatctgcccgccgattttgctgcgttg
cgtaaattgatgatgaatcatcagtaa

DBGET integrated database retrieval system