KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0497Help
Entry
ECIAI1_0497       CDS       T00828                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1 (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ecr01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(533590..534216)
Genome map
AA seq 208 aa AA seqDB search
MMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSK
TSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQD
VKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDD
GIHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaacaatgttttccgctggcatttgcccttcctgttcctggtcctgtta
accttccgtgccgccgcagcggacacgttattgattctgggtgatagcctgagcgccggg
tatcgaatgtctgccagcgcggcctggcctgccttgttgaatgataagtggcagagtaaa
acgtcggtagttaatgccagcatcagcggcgacacctcgcaacaaggactggcgcgcctt
ccggctctgctgaaacagcatcagccgcgttgggtgctggttgaactgggcggcaatgac
ggtttgcgtggttttcagccacagcaaaccgagcaaacgctgcgccagattttgcaggat
gtcaaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggt
cgccgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgtt
ccgctgctgcccttttttatggaagaggtctacctcaagccacaatggatgcaggatgac
ggtattcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttg
cagcctttagtaaatcatgactcataa

DBGET integrated database retrieval system