KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0777Help
Entry
ECIAI1_0777       CDS       T00828                                 

Gene name
ybcS
Definition
putative lysozyme; DLP12 prophage
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Brite
Enzymes [BR:ecr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECIAI1_0777 (ybcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
827270..827767
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETTRGALYLFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREICLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagccgttgctgctgctattggtggcggagcaattgctata
gcatcagtgttaatcactggcccaagtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatattgttggtgtatggactgtatgtcacgggcatacaggaaaagacatc
atgctcggtaaaacgtataccaaagcagaatgcaaagccctcctgaataaagaccttgcc
acggtcgccagacaaattaacccgtacataaaagttgatataccggaaacaacgcgcggc
gctctttacttgttcgtttacaacgtgggcgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctacgtcgctggacatat
gctggcggtaagcaatggaaaggtctcatgactcgtcgtgagattgagcgtgaaatctgt
ttgtggggtcagcaatga

DBGET integrated database retrieval system