KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1393Help
Entry
ECIAI1_1393       CDS       T00828                                 

Gene name
paaF
Definition
enoyl-CoA hydratase-isomerase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ecr01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ecr00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ecr00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ecr00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ecr00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ecr00310]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:ecr00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ecr00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ecr00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:ecr00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation [PATH:ecr00281]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:ecr00362]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ecr00627]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation [PATH:ecr00930]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1455715..1456482
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQQVLLLTLNRPAARNALNNALLTQLVNELEAAATDSSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacaagtattgttgctgacccttaaccgtccc
gccgcgcgtaatgcgctaaataatgcccttctgacgcaactggtaaatgaactggaagct
gcggctaccgatagcagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgcccgcagctatgggcgcgattgcaggccttcaacaaacctctcatcgcagccgtcaac
ggttacgcgcttggtgcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttggtttgccggaaatcactctcggcatcatgccaggcgcaggagga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcgtcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system