KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1393Help
Entry
ECIAI1_1393       CDS       T00828                                 

Gene name
paaF
Definition
enoyl-CoA hydratase-isomerase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ECIAI1_1393 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECIAI1_1393 (paaF)
   00650 Butanoate metabolism
    ECIAI1_1393 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    ECIAI1_1393 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECIAI1_1393 (paaF)
   00310 Lysine degradation
    ECIAI1_1393 (paaF)
   00360 Phenylalanine metabolism
    ECIAI1_1393 (paaF)
   00380 Tryptophan metabolism
    ECIAI1_1393 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECIAI1_1393 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECIAI1_1393 (paaF)
   00281 Geraniol degradation
    ECIAI1_1393 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECIAI1_1393 (paaF)
   00627 Aminobenzoate degradation
    ECIAI1_1393 (paaF)
   00930 Caprolactam degradation
    ECIAI1_1393 (paaF)
Enzymes [BR:ecr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECIAI1_1393 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1455715..1456482
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQQVLLLTLNRPAARNALNNALLTQLVNELEAAATDSSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacaagtattgttgctgacccttaaccgtccc
gccgcgcgtaatgcgctaaataatgcccttctgacgcaactggtaaatgaactggaagct
gcggctaccgatagcagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgcccgcagctatgggcgcgattgcaggccttcaacaaacctctcatcgcagccgtcaac
ggttacgcgcttggtgcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttggtttgccggaaatcactctcggcatcatgccaggcgcaggagga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcgtcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system