KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1393Help
Entry
ECIAI1_1393       CDS       T00828                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00071  Fatty acid degradation
ecr00280  Valine, leucine and isoleucine degradation
ecr00281  Geraniol degradation
ecr00310  Lysine degradation
ecr00360  Phenylalanine metabolism
ecr00362  Benzoate degradation
ecr00380  Tryptophan metabolism
ecr00410  beta-Alanine metabolism
ecr00627  Aminobenzoate degradation
ecr00640  Propanoate metabolism
ecr00650  Butanoate metabolism
ecr00903  Limonene and pinene degradation
ecr00930  Caprolactam degradation
ecr01100  Metabolic pathways
ecr01110  Biosynthesis of secondary metabolites
ecr01120  Microbial metabolism in diverse environments
ecr01130  Biosynthesis of antibiotics
ecr01212  Fatty acid metabolism
Module
ecr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECIAI1_1393 (paaF)
   00650 Butanoate metabolism
    ECIAI1_1393 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    ECIAI1_1393 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECIAI1_1393 (paaF)
   00310 Lysine degradation
    ECIAI1_1393 (paaF)
   00360 Phenylalanine metabolism
    ECIAI1_1393 (paaF)
   00380 Tryptophan metabolism
    ECIAI1_1393 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECIAI1_1393 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECIAI1_1393 (paaF)
   00281 Geraniol degradation
    ECIAI1_1393 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECIAI1_1393 (paaF)
   00627 Aminobenzoate degradation
    ECIAI1_1393 (paaF)
   00930 Caprolactam degradation
    ECIAI1_1393 (paaF)
Enzymes [BR:ecr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECIAI1_1393 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAQ98252
Structure
PDB: 

Jmol
Position
1455715..1456482
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQQVLLLTLNRPAARNALNNALLTQLVNELEAAATDSSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacaagtattgttgctgacccttaaccgtccc
gccgcgcgtaatgcgctaaataatgcccttctgacgcaactggtaaatgaactggaagct
gcggctaccgatagcagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgcccgcagctatgggcgcgattgcaggccttcaacaaacctctcatcgcagccgtcaac
ggttacgcgcttggtgcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttggtttgccggaaatcactctcggcatcatgccaggcgcaggagga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcgtcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system