KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1486Help
Entry
ECIAI1_1486       CDS       T00828                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ecr00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:ecr00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1557290..1558060)
Genome map
AA seq 256 aa AA seqDB search
MNLQGKTALVTGSTSGIGLGIAQTLANAGAQVILNGFGDVDAAINAVSRMGKTPGYHEAD
LSDESQIINMMAYARREFGGVDILVNNAGIQYVSPVESFPVEKWNAIIAINLSSVFHTTR
LALPEMRTRNWGRIINIASVHGLVASKDKSAYVAAKHGVVGLTKTIALETAQTGITCNAL
CPGWVLTPLVQQQIDKRIAQGEDAESARDALLAEKQPSREFVTPQQLGELALFLCSDAAA
QVRGVAWNMDGGWVAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaaggtaaaactgcgctggtgacggggtccaccagcggtatcggactcggt
attgctcagacactggcaaacgctggcgcgcaagtgatcctcaacggcttcggtgatgtt
gacgcggcaatcaatgcggtttctcgtatgggtaaaacgcctggctatcatgaggcagac
ctcagcgatgaatcgcaaattatcaacatgatggcctacgcacggcgggaatttggcggt
gtggacattctggtgaataacgccgggatccagtatgtctccccggttgaatctttccct
gtagaaaaatggaacgccattatcgctatcaatctctcttctgtctttcacaccacgcgt
ctggcactgccagaaatgcgcactcgtaactggggtcggatcattaacattgcctctgtg
catgggctggtagcgtcgaaagacaaatcagcttatgttgcggcaaaacatggcgtggtg
ggactcacaaagaccattgctctggaaactgcgcagacgggtattacctgcaacgcgctc
tgccctggctgggtgctgacgccgctggtacaacagcagattgataagcgcattgcgcaa
ggcgaagatgcggaaagcgcgcgtgacgccttactggcagaaaaacagccttctcgtgaa
tttgtgactccgcaacaactgggtgaactggcgctgtttctctgttcggatgcggcagca
caagtgcgtggggtggcgtggaatatggatggcggttgggtagcgcagtaa

DBGET integrated database retrieval system