KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1486Help
Entry
ECIAI1_1486       CDS       T00828                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ECIAI1_1486
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ECIAI1_1486
Enzymes [BR:ecr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     ECIAI1_1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1557290..1558060)
Genome map
AA seq 256 aa AA seqDB search
MNLQGKTALVTGSTSGIGLGIAQTLANAGAQVILNGFGDVDAAINAVSRMGKTPGYHEAD
LSDESQIINMMAYARREFGGVDILVNNAGIQYVSPVESFPVEKWNAIIAINLSSVFHTTR
LALPEMRTRNWGRIINIASVHGLVASKDKSAYVAAKHGVVGLTKTIALETAQTGITCNAL
CPGWVLTPLVQQQIDKRIAQGEDAESARDALLAEKQPSREFVTPQQLGELALFLCSDAAA
QVRGVAWNMDGGWVAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaaggtaaaactgcgctggtgacggggtccaccagcggtatcggactcggt
attgctcagacactggcaaacgctggcgcgcaagtgatcctcaacggcttcggtgatgtt
gacgcggcaatcaatgcggtttctcgtatgggtaaaacgcctggctatcatgaggcagac
ctcagcgatgaatcgcaaattatcaacatgatggcctacgcacggcgggaatttggcggt
gtggacattctggtgaataacgccgggatccagtatgtctccccggttgaatctttccct
gtagaaaaatggaacgccattatcgctatcaatctctcttctgtctttcacaccacgcgt
ctggcactgccagaaatgcgcactcgtaactggggtcggatcattaacattgcctctgtg
catgggctggtagcgtcgaaagacaaatcagcttatgttgcggcaaaacatggcgtggtg
ggactcacaaagaccattgctctggaaactgcgcagacgggtattacctgcaacgcgctc
tgccctggctgggtgctgacgccgctggtacaacagcagattgataagcgcattgcgcaa
ggcgaagatgcggaaagcgcgcgtgacgccttactggcagaaaaacagccttctcgtgaa
tttgtgactccgcaacaactgggtgaactggcgctgtttctctgttcggatgcggcagca
caagtgcgtggggtggcgtggaatatggatggcggttgggtagcgcagtaa

DBGET integrated database retrieval system