KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1546Help
Entry
ECIAI1_1546       CDS       T00828                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1630994..1632439)
Genome map
AA seq 481 aa AA seqDB search
MCMSGFKKGFLWGGAVAAHQLEGGWNEGGKGISIADVMTAGAHGVPREVTEGVIDGLNYP
NHEAIDFYHRYKTDIQLFAEMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFYDDLFDECL
KQGMEPVVTLSHFEMPYHLVTKYGGWRNRKLIDFFIRFASTVFTRYKEKVKYWMTFNEIN
NQVNFSESLCPFTNSGILYSPEEDINEREQIMYQAVHYELVASALAVQTGKSINPEFNIG
CMIAMCPIYPLTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKGFNLDITPE
DNAILASGCVDFIGFSYYMSFTTQFSPDNPQLDYVEPRDLVSNPYIDTSEWGWQIDPAGL
RYSLNWFWDHFQLPLFIVENGFGAVDQRQADGTVNDHYRIDYFASHIREMKKAVVEDGVD
LIGYTPWGCIDLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRDLIANNGEN
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtatgtcaggatttaaaaaaggttttttatggggcggtgcggtagccgcgcatcag
ttggaaggtggctggaatgaaggaggaaaaggcatcagcatcgctgatgtgatgactgct
ggcgctcacggggtgccgcgtgaagtgacagaaggcgttatcgacgggcttaattatccc
aatcatgaagcaattgatttttatcatcgctataaaacagatattcagttatttgccgag
atgggattcaaatgctttcgaacttccattgcctggacacgaatctttccgcaaggtgac
gaacaggagccgaatgaagagggtttacaattttatgatgatctgttcgatgaatgcctt
aagcagggaatggaacctgtggtgacgctttcacattttgagatgccttatcatctggtg
acaaaatatggtggctggcgaaaccgtaaactgatcgacttttttatccgcttcgcatca
acggtcttcacgcgctataaagaaaaagtaaagtactggatgacgtttaacgaaatcaat
aatcaggtgaatttcagcgaaagcctgtgtccatttactaattccggtatcttgtattcg
ccagaggaagatatcaatgagcgcgaacaaataatgtaccaggcggtacattacgagtta
gttgccagtgccctggcggtacagactggaaaatcgatcaatcctgaatttaacattggc
tgtatgatcgccatgtgtcccatctatcctctgacgtgtgcacccaacgatatgatgatg
gccacgaaagcaatgcatcgtcgttactggtttactgatgttcatgctcgtggatattat
ccgcaacatatgctgaattactttgccaggaaaggattcaacctcgatatcacaccagaa
gataacgcgattcttgccagtggttgtgtcgactttatcggctttagctactacatgtct
tttacgacacaattttcgcccgataacccgcaactggattatgttgaaccacgagatttg
gtcagcaacccttatatcgatacatccgaatggggatggcaaattgatccggcagggcta
cgttattcactcaactggttctgggatcatttccagttgccgctgtttattgtcgaaaat
ggatttggtgcggttgaccagagacaagctgacggcacggtgaacgatcactatcgcatt
gattactttgcttcccatattcgggaaatgaaaaaagccgtagttgaagatggtgttgac
ttaattggctacaccccgtggggctgcattgacctggtttctgccggaacaggggaaatg
aaaaagcgctacggaatgatttatgtcgataaagacaacgaagggaagggaacgctggaa
cggatacgtaaagcgtcgttttactggtatcgggatctcatcgccaacaatggcgaaaat
atttga

DBGET integrated database retrieval system