KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1818Help
Entry
ECIAI1_1818       CDS       T00828                                 

Gene name
ynjE
Definition
putative exported thiosulfate sulfur transferase / thiosulfate binding protein
Orthology
K01011  
thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Sulfur relay system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ecr00920]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ecr00270]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:ecr04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1883278..1884585
Genome map
AA seq 435 aa AA seqDB search
MKRVSQMTALAMALGLACASSWAAELAKPLTLDQLQQQNGKAIDTRPSAFYNGWPQTLNG
PSGHEPAALNLSASWLDKMSTEQLYEWIKQHNLKTDAPVALYGNDKDVDAVKTRLQKAGF
THISILSDALSEPSRLQKLPHFEQLVYPQWLHDLQQGKEVTAKPAGDWKVIEAAWGAPKL
YLISHIPGADYIDTNEVESEPLWNKVSDEQLKAMLAKHGIRHDTTVILYGRDVYAGARVA
QIMLYAGVKDVRLLDGGWQTWSDAGLPVERGTPPKVKAEPDFGVKIPAQPQLMLDMEQAR
GLLHRQDASLVSIRSWPEFIGTTSGYSYIKPKGEIAGARWGHAGSDSTHMEDFHNPDGTM
RSADDITAMWKAWNIKPEQQVSFYCGTGWRASETFMYARAMGWKNVSVYDGGWYEWSSDP
KNPVATGERGPDSSK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgtttctcaaatgaccgcgctggcaatggctttagggctggcttgcgcttct
tcgtgggccgctgaactggcgaagcctcttacacttgaccagcttcaacaacaaaatggc
aaagcgatagatactcgccccagcgcgttttataacggctggccacaaaccttaaatggc
ccttctggtcatgaacctgccgccttaaacctctctgccagctggctcgacaaaatgagc
accgaacagctctatgagtggatcaagcaacataatctgaaaaccgatgctccggtggcg
ctgtacggcaatgacaaagatgtcgacgccgtcaaaacgcgtctgcaaaaagcaggtttt
acgcatatctccattctgagtgacgcgctaagcgaaccttcccgtctacaaaaactgccg
cactttgagcagctggtttatccgcaatggctgcacgacctgcaacaaggtaaagaggtt
acggcgaaacctgccggtgactggaaagtcattgaagcggcctggggcgctcctaagctt
taccttatcagccatattcctggcgctgactacatcgataccaacgaagtggaaagcgaa
ccgctgtggaacaaagtttctgatgaacaactaaaagcgatgctggcaaaacacggcatt
cgccatgacaccacggtcattctgtacgggcgtgacgtatacgctggagcgcgtgtggcg
caaattatgctctacgcaggcgtgaaagatgtgcgtctgctggatggcggctggcaaacc
tggtccgacgcgggactgcctgttgagcgaggaacgccaccgaaagtgaaagcggaaccg
gatttcggcgtgaagatcccggcacaaccgcagttgatgctcgatatggaacaggcccgt
ggactgctgcatcgccaggatgcatcgctggtgagcattcgttcgtggccagaatttatc
ggtacgaccagcggttacagctatattaaaccaaaaggtgaaatagccggagcacgttgg
ggacacgctggtagcgactcgacgcatatggaagattttcataacccggatggcaccatg
cgcagcgccgatgatattaccgctatgtggaaagcgtggaatatcaaaccagagcagcaa
gtttcattctactgcggcaccggctggcgcgcgtccgaaacctttatgtacgcacgcgcc
atgggttggaagaatgtttccgtgtatgacggcggctggtacgaatggagcagcgatcca
aaaaatccggtagcaaccggtgaacgcggcccggacagtagcaaataa

DBGET integrated database retrieval system