KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1818Help
Entry
ECIAI1_1818       CDS       T00828                                 

Gene name
ynjE
Definition
(GenBank) putative exported thiosulfate sulfur transferase / thiosulfate binding protein
  KO
K21028  
molybdopterin synthase sulfurtransferase [EC:2.8.1.11]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ecr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    ECIAI1_1818 (ynjE)
Enzymes [BR:ecr01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.11  molybdopterin synthase sulfurtransferase
     ECIAI1_1818 (ynjE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
1883278..1884585
Genome map
AA seq 435 aa AA seqDB search
MKRVSQMTALAMALGLACASSWAAELAKPLTLDQLQQQNGKAIDTRPSAFYNGWPQTLNG
PSGHEPAALNLSASWLDKMSTEQLYEWIKQHNLKTDAPVALYGNDKDVDAVKTRLQKAGF
THISILSDALSEPSRLQKLPHFEQLVYPQWLHDLQQGKEVTAKPAGDWKVIEAAWGAPKL
YLISHIPGADYIDTNEVESEPLWNKVSDEQLKAMLAKHGIRHDTTVILYGRDVYAGARVA
QIMLYAGVKDVRLLDGGWQTWSDAGLPVERGTPPKVKAEPDFGVKIPAQPQLMLDMEQAR
GLLHRQDASLVSIRSWPEFIGTTSGYSYIKPKGEIAGARWGHAGSDSTHMEDFHNPDGTM
RSADDITAMWKAWNIKPEQQVSFYCGTGWRASETFMYARAMGWKNVSVYDGGWYEWSSDP
KNPVATGERGPDSSK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgtttctcaaatgaccgcgctggcaatggctttagggctggcttgcgcttct
tcgtgggccgctgaactggcgaagcctcttacacttgaccagcttcaacaacaaaatggc
aaagcgatagatactcgccccagcgcgttttataacggctggccacaaaccttaaatggc
ccttctggtcatgaacctgccgccttaaacctctctgccagctggctcgacaaaatgagc
accgaacagctctatgagtggatcaagcaacataatctgaaaaccgatgctccggtggcg
ctgtacggcaatgacaaagatgtcgacgccgtcaaaacgcgtctgcaaaaagcaggtttt
acgcatatctccattctgagtgacgcgctaagcgaaccttcccgtctacaaaaactgccg
cactttgagcagctggtttatccgcaatggctgcacgacctgcaacaaggtaaagaggtt
acggcgaaacctgccggtgactggaaagtcattgaagcggcctggggcgctcctaagctt
taccttatcagccatattcctggcgctgactacatcgataccaacgaagtggaaagcgaa
ccgctgtggaacaaagtttctgatgaacaactaaaagcgatgctggcaaaacacggcatt
cgccatgacaccacggtcattctgtacgggcgtgacgtatacgctggagcgcgtgtggcg
caaattatgctctacgcaggcgtgaaagatgtgcgtctgctggatggcggctggcaaacc
tggtccgacgcgggactgcctgttgagcgaggaacgccaccgaaagtgaaagcggaaccg
gatttcggcgtgaagatcccggcacaaccgcagttgatgctcgatatggaacaggcccgt
ggactgctgcatcgccaggatgcatcgctggtgagcattcgttcgtggccagaatttatc
ggtacgaccagcggttacagctatattaaaccaaaaggtgaaatagccggagcacgttgg
ggacacgctggtagcgactcgacgcatatggaagattttcataacccggatggcaccatg
cgcagcgccgatgatattaccgctatgtggaaagcgtggaatatcaaaccagagcagcaa
gtttcattctactgcggcaccggctggcgcgcgtccgaaacctttatgtacgcacgcgcc
atgggttggaagaatgtttccgtgtatgacggcggctggtacgaatggagcagcgatcca
aaaaatccggtagcaaccggtgaacgcggcccggacagtagcaaataa

DBGET integrated database retrieval system