KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1844Help
Entry
ECIAI1_1844       CDS       T00828                                 

Gene name
yeaD
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1907661..1908545
Genome map
AA seq 294 aa AA seqDB search
MIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLW
LSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDADGVALTFE
LTQSEETKKFWPHDFTLLAHFRVGKTCEIDLESHGEFETTSALHTYFNVGDIAKVSVSGL
GDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatttttgcccttccggtcatcgaacaaatctcccctgtcctctcccgt
cgtaaactggatgaactggacctcattgtggtcgatcatccccaggtaaaagcctctttt
gcattacagggcgcacaccttctctcgtggaaacctgcgggtgaagaagaagttctgtgg
ttgagcaacaacacaccgttcaaaaatggcgtcgctattcgcggtggcgtaccggtttgc
tggccgtggtttggtccggcggcacaacaaggtctgcctgcgcacggttttgcccgcaac
ctgccgtggacgctgaaatcacatcgtgaagatgctgatggcgtagcgctgacttttgaa
ttgacgcaaagcgaagagacgaaaaaattctggccgcacgactttacgctgttagcgcat
ttccgcgtgggtaaaacctgtgaaatcgatcttgaatcacatggcgaatttgaaaccacc
tctgccctgcatacctactttaacgtgggtgatatcgctaaggtaagcgtcagtgggctg
ggcgatcgcttcattgataaagtaaatgacgcgaaagaagatgtactgaccgacggtatt
cagaccttccctgaccgtaccgatcgcgtgtatctgaatccgcaagattgcagcgtgatt
aatgatgaagcgctgaatcgtattatcgccgtaggccaccagcatcatctgaacgttgtc
ggctggaacccgggaccggcgctttcagttagcatgggcgacatgccggatgatggctac
aaaacatttgtttgtgtagaaacggcttacgcttcagaaacgcaaaaagtgaccaaagag
aaacctgcacatctggcgcaatccattcgcgttgcgaaacgttaa

DBGET integrated database retrieval system