KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_2513Help
Entry
ECIAI1_2513       CDS       T00828                                 

Gene name
tktB
Definition
transketolase (EC:2.2.1.1)
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:ecr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ecr01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ecr00030]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of ansamycins
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2603022..2605025
Genome map
AA seq 667 aa AA seqDB search
MSRKDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLKHNPTDPTWYDRDRFI
LSNGHASMLLYSLLHLTGYDLPLEELKNFRQLHSKTPGHPEIGYTPGVETTTGPLGQGLA
NAVGLAIAERTLAAQFNQPDHEIVDHFTYVFMGDGCLMEGISHEVCSLAGTLGLGKLIGF
YDHNGISIDGETEGWFTDDTAKRFEAYHWHVIHEIDGHDPQAVKEAILEAQSVKDKPSLI
ICRTVIGFGSPNKAGKEEAHGAPLGEEEVALARQKLGWHHPPFEIPKKIYHAWDAREKGE
KAQQSWNEKFAAYKKAHPQLAEEFTRRMSGGLPKDWEKTTQKYINELQANPAKIATRKAS
QNTLNAYGPMLPELLGGSADLAPSNLTIWKGSVSLKEDPAGNYIHYGVREFGMTAIANGI
AHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVYTHDSIGLGEDGPTHQAVEQLAS
LRLTPNFSTWRPCDQVEAAVGWKLAVERHNGPTALILSRQNLAQVERTPDQVKEIARGGY
VLKDSGGKPDIILIATGSEMEITLQAAEKLAGEGRNVRVVSLPSTDIFDAQDEEYRESVL
PSNVAARVAVEAGIADYWYKYIGLKGAIVGMTGYGESAPADKLFPFFGFTAENIVAKAHK
VLGVKGA
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgaaaagaccttgccaatgcgattcgcgcactcagtatggatgcggtacaaaaa
gccaattctggtcatcccggcgcgccgatgggcatggctgatattgccgaagtgctgtgg
aacgattttcttaaacataatcctaccgacccaacctggtatgatcgcgaccgctttatt
ctttccaacggtcacgcgtcgatgctgctctacagtttgctacatctgaccggttacgac
ctgccgctggaagaactgaagaacttccgtcagttgcattcgaaaaccccaggccacccg
gagattggctatacgccaggcgttgaaaccaccaccggcccgcttggacaaggtttggcg
aacgccgtcgggctggcgatagcggaacgtacactggcggcgcagtttaaccagccagac
catgagatcgtcgatcacttcacctatgtgtttatgggcgacggctgcctgatggaaggt
atttcccacgaagtctgttcgctggcaggcacgctgggactgggcaagctgattggtttt
tacgatcacaacggtatttccatcgacggtgaaacagaaggctggtttaccgacgatacg
gcaaaacgttttgaagcctatcactggcatgtgatccatgaaatcgacggtcacgatccg
caggcggtgaaggaagcgatccttgaagcgcaaagcgtgaaagataagccgtcgctgatt
atctgccgtacggtgattggctttggttcgccgaataaagcaggtaaggaagaggcgcac
ggcgcaccactgggggaagaagaagtggcgctggcacggcaaaaactgggctggcaccat
ccgccatttgagatccctaaaaagatttatcacgcctgggatgcccgtgaaaaaggcgaa
aaagcgcagcagagctggaatgagaagtttgccgcctataaaaaggctcatccgcaactg
gcagaagagtttacccgacggatgagcggtggtttaccgaaggactgggagaaaacgact
cagaaatatatcaatgagttacaggcaaatccggcgaaaatcgctacccgtaaggcttcg
caaaatacgcttaacgcttacgggccgatgctgcctgagttgctcggcggttcggcggat
ctggctcccagcaacctgaccatctggaaaggttctgtttcgctgaaggaagatccagcg
ggcaactacattcactacggggtgcgtgaatttggcatgaccgctatcgccaacggcatc
gcgcaccacggcggctttgtgccgtataccgcgacgttcctgatgtttgttgaatacgcc
cgtaacgccgcgcggatggcggcactgatgaaagcgcggcagattatggtttatacccac
gactcaattggcctgggcgaagatggtccgacgcaccaggctgttgagcaactggccagc
ctgcgcttaacgccaaatttcagcacctggcgaccgtgcgatcaggtggaagcggcggtg
ggctggaagctggcggttgagcgccacaacggaccgacggcactgatcctctcaaggcag
aatctggcccaggtggaacgtacgccggatcaggttaaagagattgctcgtggcggttat
gtgctgaaagacagcggcggtaagccagatattattctgattgccaccggttcagagatg
gaaattaccctgcaagcggcagagaaattagcaggagaaggtcgcaatgtacgcgtagtt
tccctgccctcgaccgatattttcgacgcccaggatgaggaatatcgggagtcggtgttg
ccttctaacgttgcggctcgcgtggcggtggaagcaggtattgccgattactggtacaag
tatattggtctgaaaggggcaattgtcgggatgacgggttacggggaatctgctccggcg
gataagctgttcccgttctttggctttaccgccgagaatattgtggcaaaagcgcataag
gtgctgggagtgaaaggtgcctga

DBGET integrated database retrieval system