KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_2927Help
Entry
ECIAI1_2927       CDS       T00828                                 

Gene name
recD
Definition
(GenBank) exonuclease V (RecBCD complex), alpha chain
  KO
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ECIAI1_2927 (recD)
Enzymes [BR:ecr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ECIAI1_2927 (recD)
DNA repair and recombination proteins [BR:ecr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ECIAI1_2927 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(3001936..3003762)
Genome map
AA seq 608 aa AA seqDB search
MKLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHDAGEGHVCLPLSRLEN
NEASHPLLATCVSEIGELQNWEECLLASQAVSRGDEPTPMILCGDRLYLNRMWCNERTVA
RFFNEVNHAIEVDEALLAQTLDKLFPVSDEINWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRDQ
LASVEAGAVLGDICAYANAGFTAERAGQLSRLTGTHVPAGTGTEAASLRDSLCLLQKSYR
FGSDSGIGQLAAAINRGDKTAVKTVFQQDFTDIEKRLLQSGEDYIAMLEEALAGYGRYLD
LLQARAEPDLIIQAFNEYQLLCALREGPFGVAGLNERIEQFMQQKRKIHRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGTRVWFAMPDGNIKSVQPSRLPEHETTWAMTVHK
SQGSEFDHAALILPSQRTPVVTRELVYTAVTRARRRLSLYADERILSAAIATRTERRSGL
AALFSSRE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcaaaagcaattactggaagctgtggagcacaaacagctacgcccgctggat
gtgcaatttgccctgaccgtggcgggagatgaacatcctgccgtcaccctcgcggcggca
ctgttaagtcatgatgccggagagggacacgtctgtttgccgctttcacgactggaaaat
aacgaggcgtcgcatccgctgttggcgacctgtgtcagtgaaatcggtgagctacaaaat
tgggaagaatgcttgctggcttctcaagcggtcagcaggggagatgaacccacgccgatg
atcctctgtggcgatcgtctttatttgaatcgcatgtggtgtaacgagcggacggtagcg
cgcttcttcaatgaggtgaatcatgccattgaggttgatgaagctctactggcgcaaacc
ctggacaaactttttccagtaagcgatgaaattaactggcaaaaagttgcagcggcagtg
gcgctgacgcggcggatctcggtgatttccggcggcccaggcaccggtaaaacgaccacc
gtggcgaagttactggcagcgttaattcaaatggccgacggcgaacgctgccgtatccgt
ctggctgcaccaacgggtaaagctgccgcgcgcttaaccgaatctctcggcaaggctttg
cgacagttaccgctgaccgatgaacaaaagaaacgcattccggaagatgccagtactttg
caccgattgctgggtgcgcagccgggtagccagcgtttacgtcatcatgccggtaacccg
ctgcatcttgatgtgctggtggtagatgaagcgtcaatgatcgatctgcctatgatgtcg
agactgatcgacgccttgcccgatcatgcgcgagtgatctttctcggcgatcgtgatcaa
ctggcctcggttgaggctggggctgtgctgggcgatatctgcgcttatgccaatgccggc
tttaccgccgagcgtgccgggcagctaagccgcctgacgggaactcacgttccggcagga
actggcacagaagcggcatctttgcgcgacagtctctgcctgctgcaaaaaagctatcgt
ttcggcagtgattctggcattggtcagttagctgcggcgatcaaccgtggtgataaaacg
gcagtgaaaaccgtttttcagcaggattttactgatatcgaaaaacggcttttacagagc
ggagaagattatattgcgatgcttgaggaagctcttgcgggttatggacgttatctggat
ctgctgcaagcgcgtgccgagccggatttaatcattcaggcgttcaatgagtaccaactt
ttgtgcgccctgcgggaagggccgtttggcgtggctggactgaatgagcgaattgagcag
tttatgcaacagaagcgcaaaattcatcgtcatccgcactctcgttggtacgaaggtcga
ccggtaatgattgcccgtaatgacagcgcgcttgggttgtttaatggcgatatcggtatt
gcgctggatcgcgggcaggggacgcgcgtctggtttgcgatgccggacggcaatattaag
tctgtgcaaccgagtcgcttgccagagcacgaaactacgtgggcgatgacggtacataaa
tcgcagggatcggagttcgaccatgcggcgttgattttaccgagccaacgcacgccggta
gtaacgcgagagctggtatacaccgcggtgacccgcgcgcgtcgccgtctgtcgctgtat
gccgatgagcgtatattaagtgcggcaatcgccactcgtactgagcggcgcagtggtctg
gcggcgttgtttagttcgcgggaataa

DBGET integrated database retrieval system