KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_4124Help
Entry
ECIAI1_4124       CDS       T00828                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECIAI1_4124 (tpiA)
   01230 Biosynthesis of amino acids
    ECIAI1_4124 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECIAI1_4124 (tpiA)
   00051 Fructose and mannose metabolism
    ECIAI1_4124 (tpiA)
   00562 Inositol phosphate metabolism
    ECIAI1_4124 (tpiA)
Enzymes [BR:ecr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECIAI1_4124 (tpiA)
Exosome [BR:ecr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECIAI1_4124 (tpiA)
  Exosomal proteins of bladder cancer cells
   ECIAI1_4124 (tpiA)
  Exosomal proteins of melanoma cells
   ECIAI1_4124 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(4191843..4192610)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacttctgcc
gctatgctgaaagacatcggcgctcagtacatcatcatcggccactctgaacgtcgtact
taccacaaagagtctgacgaactgattgcgaaaaaattcgcggtgctgaaagagcagggt
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggaaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagacatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgcagtgatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system