KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_4302Help
Entry
ECIAI1_4302       CDS       T00828                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00010  Glycolysis / Gluconeogenesis
ecr00620  Pyruvate metabolism
ecr00640  Propanoate metabolism
ecr00680  Methane metabolism
ecr01100  Metabolic pathways
ecr01110  Biosynthesis of secondary metabolites
ecr01120  Microbial metabolism in diverse environments
ecr01130  Biosynthesis of antibiotics
ecr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECIAI1_4302 (acs)
   00620 Pyruvate metabolism
    ECIAI1_4302 (acs)
   00640 Propanoate metabolism
    ECIAI1_4302 (acs)
  Energy metabolism
   00680 Methane metabolism
    ECIAI1_4302 (acs)
Enzymes [BR:ecr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ECIAI1_4302 (acs)
Lipid biosynthesis proteins [BR:ecr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ECIAI1_4302 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAR01049
Position
complement(4376521..4378479)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINVPDTFWGEQGKILDWIKPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDL
VEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgtacctgataccttctggggc
gaacagggaaaaattcttgactggatcaaaccttaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatatcagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcgagctgggcattaaaaaaggtgatgtggtggcgatttatatgccg
atggtgccggaagccgcggttgcgatgctggcctgcgcccgcattggcgcggtgcattcg
gtgattttcggcggcttctcgccggaagccgttgccgggcgcattattgattccaactca
cgactggtgatcacttccgacgaaggtgtgcgtgccgggcgcagtattccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggcgggaaaattgactggcaggaagggcgcgacctgtggtggcacgacctg
gttgagcaagcgagcgatcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctacacctccggttctaccggtaagccaaaaggtgtgctgcatactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggtgatatc
tactggtgcaccgccgatgtgggctgggtgaccggacacagttacttgctgtacggcccg
ctggcctgcggtgcgaccacgctgatgtttgaaggcgtacccaactggccgacgcctgcc
cgtatggcgcaggtggtggacaagcatcaggtcaatattctctataccgcacccacggcg
atccgcgcgctgatggcggaaggcgataaagcgatcgagggtaccgaccgttcgtcgctg
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaaa
aaaatcggcaacgagaaatgtccggtggtcgatacctggtggcagaccgaaactggcggt
ttcatgatcacgccgctgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccggcgctggtcgataacgaaggtaacccgctggaaggcgctacc
gaaggcagcctggtgatcaccgactcctggccgggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgaacagacctacttctccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagatggctattactggatcaccgggcgtgtggacgacgtgctg
aacgtctccggtcaccgtctggggacggcagagattgagtcggcgctggtggcgcatccg
aagattgccgaagccgccgtagtaggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctacgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggctatcgcgatgccatcgtaa

DBGET integrated database retrieval system