KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0004Help
Entry
ECs0004           CDS       T00048                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00260  Glycine, serine and threonine metabolism
ecs00750  Vitamin B6 metabolism
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01120  Microbial metabolism in diverse environments
ecs01230  Biosynthesis of amino acids
Module
ecs_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECs0004
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ECs0004
Enzymes [BR:ecs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ECs0004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 913393
NCBI-ProteinID: NP_308031
UniProt: Q8XA80
Structure
PDB: 

Jmol
Position
3751..5037
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
RKLMMNHQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatcttaaagatcacaatgagcaggtcagctttgcgcaagccgtaacc
caggggttgggcaaaaatcaggggctgttttttccgcacgacctgccggaattcagcctg
actgaaattgatgagatgctgaagctggattttgtcacccgcagtgcgaagatcctctcg
gcgtttattggtgatgaaatcccgcaggaaatcctggaagagcgcgtgcgcgcggcgttt
gccttcccggctccggtcgccaatgttgaaagcgatgtcggttgtctggaattgttccac
gggccaacgctggcatttaaagatttcggcggtcgctttatggcacaaatgctgacccat
attgcgggcgataagccagtgaccattctgaccgcgacctccggtgataccggagcggca
gtggctcatgctttctacggtttaccgaatgtgaaagtggttatcctttatccacgaggc
aaaatcagtccactgcaagaaaaactgttctgtacattgggcggcaatatcgaaactgtt
gccatcgacggcgatttcgatgcctgtcaggcgctggtgaagcaggcgtttgatgatgaa
gagctgaaagtggcgctggggttaaactcagctaactcgattaacattagccggttgctg
gcgcagatttgctactactttgaagcagttgcgcagctgccgcaggaagcgcgcaaccag
ctggttgtctcggtgccaagcggaaacttcggcgatttgacggcgggtctgctggcgaag
tcactcggtctgccggtgaaacgttttattgctgcgaccaacgtgaacgataccgtgcca
cgtttcctgcatgacggtcagtggtcacccaaagcgactcaggcgacgttatccaacgcg
atggacgtgagtcagccgaacaactggccgcgtgtggaagagttgttccgccgcaaaatc
tggcaactgaaagagctgggttatgccgccgtggatgatgaaaccacgcaacagacaatg
cgtgagttaaaagaactgggctacacttcggagccgcacgctgccgtagcgtatcgtgcg
ctgcgtgaccagttgaatccaggcgaatatggcttgttcctcggcaccgcgcatccggcg
aaatttaaagagagcgtggaagcgattctcggtgaaacgttggatctgccaaaagagctg
gcagaacgtgccgatttacccttgctttcgcataatctgcccgccgattttgctgcgttg
cgtaaattgatgatgaatcatcagtaa

DBGET integrated database retrieval system