KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0082Help
Entry
ECs0082           CDS       T00048                                 

Gene name
ilvH
Definition
acetolactate synthase 3 regulatory subunit (EC:2.2.1.6)
Orthology
K01653  
acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
Valine, leucine and isoleucine biosynthesis
Butanoate metabolism
C5-Branched dibasic acid metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:ecs01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ecs01230]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ecs00650]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:ecs00660]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:ecs00290]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:ecs00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91962..92453
Genome map
AA seq 163 aa AA seqDB search
MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI
EKQLYKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLY
TVQLAGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgccggatattatcagtcttactcgaaaatgaatcaggcgcgttatcccgcgtgatt
ggccttttttcccagcgtggctacaacattgaaagcctgaccgttgcgccaaccgacgat
ccgacattatcgcgtatgaccatccagaccgtgggcgatgaaaaagtgcttgagcagatc
gaaaagcaattatacaagctggtcgatgtcttgcgcgtgagtgagttggggcagggcgcg
catgttgagagggaaatcatgctggtgaaaattcaggccagcggttacgggcgtgacgaa
gttaaacgtaatacggaaatattccgtgggcaaattattgatgtcacaccctcgctttat
accgttcaattagcaggcaccagcgataagcttgatgcatttttagcatcgattcgcgat
gtggcgaaaattgtggaagttgctcgctctggtgtggtcggactttcgcgcggcgataaa
ataatgcgttga

DBGET integrated database retrieval system