KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0146Help
Entry
ECs0146           CDS       T00048                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECs0146
Enzymes [BR:ecs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ECs0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(161572..162054)
Genome map
AA seq 160 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVA
LETTLAPEELLNHTQQIELQQGRVRKAERWGPRTLDLDIMLFGNETINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGETLREILTSLAVLQPAIWY
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatatccctgaaagccacattcttaccgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacttaaacgcagccgtggcg
ctggaaacaacacttgcgcctgaagaattacttaatcacacacagcaaatagagttgcag
caaggtcgcgttcgtaaagcagaacgctggggaccgcgcacactcgatcttgatatcatg
ttgtttggtaatgaaaccattaataccgaacgactcaccgtcccgcattacgatatgaag
aatcgcggctttatgctgtggccgctgtttgagattgccccggaactcgtgtttcctgat
ggggagacattacgtgaaatactcacttcgctagcagtactacaacctgccatctggtat
tag

DBGET integrated database retrieval system