KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0747Help
Entry
ECs0747           CDS       T00048                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00020  Citrate cycle (TCA cycle)
ecs00190  Oxidative phosphorylation
ecs00650  Butanoate metabolism
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01120  Microbial metabolism in diverse environments
ecs01130  Biosynthesis of antibiotics
ecs01200  Carbon metabolism
Module
ecs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecs_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECs0747 (sdhD)
   00650 Butanoate metabolism
    ECs0747 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECs0747 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-GeneID: 917478
NCBI-ProteinID: NP_308774
UniProt: Q8X9A9
Structure
PDB: 

Jmol
Position
832205..832552
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFCASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgagctgacatatgaagtctggatcggtttctgcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggctttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system