KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs1784Help
Entry
ECs1784           CDS       T00048                                 

Definition
(RefSeq) endolysin
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Brite
Enzymes [BR:ecs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECs1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme DUF951
Motif
Other DBs
NCBI-GeneID: 913044
NCBI-ProteinID: NP_309811
UniProt: Q7AEQ9
Position
1777316..1777849
Genome map
AA seq 177 aa AA seqDB search
MNAKIRYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTTAYRDGAGIWTICRGATRGDG
KPVIPGMKLSKEKCDRVNAIERDKALAWVEKNIRVPLTEPQKAGIASFCPYNIGPGKCFP
STFYRRINAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaaatcagatacggcctgtcggctgccgttctggcgctgattggtgcaggg
gcgtctgcgcctgaaatcctcgaccagtttctggatgaaaaggaaggtaaccacaccaca
gcataccgtgatggtgcgggtatctggaccatctgccgtggagccacccggggggatggt
aagcctgttattcctggcatgaagctgtcgaaggaaaaatgcgaccgggttaacgccatt
gagcgtgataaggcgctggcatgggtggagaaaaacatcagagtgccgctgaccgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggccccggtaagtgtttcccg
tcgacgttttacagacggattaatgcaggagatcgaaaaggtgcctgcgaagcgattcgc
tggtggattaaggacggtggcagggactgccgtattcgctcaaataactgttacggtcag
gtatcccgtcgtgaccaggagagcgcgctggcgtgctggggaatcgacagataa

DBGET integrated database retrieval system