KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs2429Help
Entry
ECs2429           CDS       T00048                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECs2429
   01230 Biosynthesis of amino acids
    ECs2429
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECs2429
   00030 Pentose phosphate pathway
    ECs2429
   00051 Fructose and mannose metabolism
    ECs2429
   00052 Galactose metabolism
    ECs2429
  Energy metabolism
   00680 Methane metabolism
    ECs2429
Enzymes [BR:ecs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECs2429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2406081..2407013
Genome map
AA seq 310 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIF
PAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQNQGIRCIIDSSGEALSAALAIG
NIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCI
QVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDD
TQKIYAYLSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttc
ccggcgggtggcgcgaccggcgaacacctggtttcactgttggcggatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagcttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaccaa
gggatccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aacatcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactc
acccagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaa
cgggttgtcgtttccctgggtccacaaggagcgctgggtgttgatagtgaaaactgcatt
caggtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgatagcatggtc
ggcgcgatgacactgaaactggcagaaaatgcctctcttgaagagatggttcgttttggc
gtagctgcggggagtgcagccacactcaatcagggaacacgtctgtgctcccatgacgat
acgcaaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system