KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs2821Help
Entry
ECs2821           CDS       T00048                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00340  Histidine metabolism
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01230  Biosynthesis of amino acids
Module
ecs_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ECs2821 (hisD)
Enzymes [BR:ecs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ECs2821 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 912702
NCBI-ProteinID: NP_310848
UniProt: Q8X8T3
Structure
PDB: 

Jmol
Position
2763162..2764466
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAKQQRQLLMRPAISASESITRTVNDILDSVKARGDDALREYSAKFDK
TTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMAHQVAEAVERQLAELPRAETARQ
ALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKVGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcaaagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaagcattacccgcactgttaacgatattctc
gatagcgtgaaagcacgcggtgatgacgccctgcgggaatatagcgcgaagtttgataaa
accacggttaccgcactgaaggtgtctgctgaggaaattgccgccgccagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgccagcaagtc
acgcgcccggtagcttcagttgggttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcaactccggcgcgtattgcgggctgtaaaaaagtggtgttgtgc
tcaccgccgccgattgccgatgagatcctttatgcggcgcagctgtgcggtgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcgctggcgtttggtacggaatctgtg
ccgaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaggcaaaacgtcag
gtgagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgttg
gtcattgccgacagcggcgcaacgccggatttcgtggcttctgatttgctttctcaggct
gaacacggcccggactcacaggtgattttactgacgcctgacgctgatatggcgcatcaa
gttgccgaagccgtcgaacgccagttagcagaactgccgcgtgccgaaaccgcccgccag
gcactgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtggagatctcc
aaccagtacggcccggagcacctgatcattcagacccgcaacgcccgcgaactggtcgat
ggcatcaccagcgccggttcggtatttcttggtgactggtcaccggaatcggcaggtgat
tacgcctccggaaccaaccatgttctaccgacttacggctacaccgccacctgttccagc
ctcggactggcggatttccagaagcggatgaccgtgcaggaactgtcgaaagtaggtttc
tccgcgctggcttcgaccattgaaacactggccgccgccgagcgcctgaccgcccacaaa
aatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system